BLASTP 2.2.23 [Feb-03-2010] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= Q9UUB7 (85 letters) Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta 36,641 sequences; 10,336,785 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value 3VIR-A nrPDB 172 2e-44 3EC1-A nrPDB 28 0.77 1W7P-D nrPDB 28 0.95 1U5T-B nrPDB 28 0.98 5FWP-E nrPDB 25 7.5 4AZV-A nrPDB 25 7.9 5H7W-A nrPDB 25 9.1 3SKS-A nrPDB 25 9.4 >3VIR-A nrPDB Length = 85 Score = 172 bits (437), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 85/85 (100%), Positives = 85/85 (100%) Query: 1 MEKSQLESRVHLLEQQKEQLESSLQDALAKLKNRDAKQTVQKHIDLLHTYNEIRDIALGM 60 MEKSQLESRVHLLEQQKEQLESSLQDALAKLKNRDAKQTVQKHIDLLHTYNEIRDIALGM Sbjct: 1 MEKSQLESRVHLLEQQKEQLESSLQDALAKLKNRDAKQTVQKHIDLLHTYNEIRDIALGM 60 Query: 61 IGKVAEHEKCTSVELFDRFGVNGSE 85 IGKVAEHEKCTSVELFDRFGVNGSE Sbjct: 61 IGKVAEHEKCTSVELFDRFGVNGSE 85 >3EC1-A nrPDB Length = 369 Score = 28.5 bits (62), Expect = 0.77, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 7/57 (12%) Query: 34 RDAKQTVQKHIDLLHTYNEIRDIA------LGMIGKVAEHEKCTSVELFDRFGVNGS 84 +DA++ + + L YNE++D+ L M+ ++ E K V + D F NGS Sbjct: 32 KDAEEVICQRCFRLKHYNEVQDVPLDDDDFLSMLHRIGE-SKALVVNIVDIFDFNGS 87 >1W7P-D nrPDB Length = 566 Score = 28.1 bits (61), Expect = 0.95, Method: Compositional matrix adjust. Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Query: 33 NRDAKQTVQKHIDLLHTYNEIRDIALGMIGKVAEHEKCTSVELFDRFGVN 82 N D + +DL YN+ I G+I + E C E F+ G+N Sbjct: 427 NSDTNYMIITLVDLYAMYNKSMRIGTGLISPMEMREAC---ERFEHLGLN 473 >1U5T-B nrPDB Length = 169 Score = 28.1 bits (61), Expect = 0.98, Method: Compositional matrix adjust. Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Query: 33 NRDAKQTVQKHIDLLHTYNEIRDIALGMIGKVAEHEKCTSVELFDRFGVN 82 N D + +DL YN+ I G+I + E C E F+ G+N Sbjct: 32 NSDTNYMIITLVDLYAMYNKSMRIGTGLISPMEMREAC---ERFEHLGLN 78 >5FWP-E nrPDB Length = 378 Score = 25.0 bits (53), Expect = 7.5, Method: Compositional matrix adjust. Identities = 11/22 (50%), Positives = 16/22 (72%) Query: 24 LQDALAKLKNRDAKQTVQKHID 45 LQDA++K+ DAK +Q+ ID Sbjct: 317 LQDAISKMDPTDAKYHMQRCID 338 >4AZV-A nrPDB Length = 569 Score = 25.0 bits (53), Expect = 7.9, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Query: 6 LESRVHLLEQQKEQLESSLQDALAK 30 L ++H LEQQ QL+S+ QDA + Sbjct: 503 LRGQIHTLEQQMAQLQSA-QDAFVE 526 >5H7W-A nrPDB Length = 529 Score = 24.6 bits (52), Expect = 9.1, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 18/32 (56%) Query: 31 LKNRDAKQTVQKHIDLLHTYNEIRDIALGMIG 62 L+ RD + +QKH D L T + IALG G Sbjct: 166 LEFRDEVEELQKHADKLTTLGVNKIIALGHSG 197 >3SKS-A nrPDB Length = 567 Score = 24.6 bits (52), Expect = 9.4, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Query: 18 EQLESSLQDALAKLKNRDAKQTVQKHIDLLHTYNEIRD 55 E+L+ AL K N +TV++ ++H+ NEIR+ Sbjct: 17 EELKEKFTVALEKFDN---AKTVEEQKQVIHSINEIRN 51 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: 3VIR-A nrPDB 151 1e-37 Sequences not found previously or not previously below threshold: 3EC1-A nrPDB 29 0.50 1SMQ-A nrPDB 29 0.63 1W7P-D nrPDB 29 0.71 1U5T-B nrPDB 29 0.71 4AZV-A nrPDB 27 2.0 1LDK-A nrPDB 27 2.2 3SKS-A nrPDB 27 2.2 1U6G-A nrPDB 26 4.2 5L4K-V nrPDB 25 5.7 5H7W-A nrPDB 25 6.4 2CG5-B nrPDB 25 7.8 5JM5-A nrPDB 25 8.8 CONVERGED! >3VIR-A nrPDB Length = 85 Score = 151 bits (380), Expect = 1e-37, Method: Composition-based stats. Identities = 85/85 (100%), Positives = 85/85 (100%) Query: 1 MEKSQLESRVHLLEQQKEQLESSLQDALAKLKNRDAKQTVQKHIDLLHTYNEIRDIALGM 60 MEKSQLESRVHLLEQQKEQLESSLQDALAKLKNRDAKQTVQKHIDLLHTYNEIRDIALGM Sbjct: 1 MEKSQLESRVHLLEQQKEQLESSLQDALAKLKNRDAKQTVQKHIDLLHTYNEIRDIALGM 60 Query: 61 IGKVAEHEKCTSVELFDRFGVNGSE 85 IGKVAEHEKCTSVELFDRFGVNGSE Sbjct: 61 IGKVAEHEKCTSVELFDRFGVNGSE 85 >3EC1-A nrPDB Length = 369 Score = 28.9 bits (63), Expect = 0.50, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 7/57 (12%) Query: 34 RDAKQTVQKHIDLLHTYNEIRDIA------LGMIGKVAEHEKCTSVELFDRFGVNGS 84 +DA++ + + L YNE++D+ L M+ ++ E K V + D F NGS Sbjct: 32 KDAEEVICQRCFRLKHYNEVQDVPLDDDDFLSMLHRIGE-SKALVVNIVDIFDFNGS 87 >1SMQ-A nrPDB Length = 399 Score = 28.5 bits (62), Expect = 0.63, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Query: 17 KEQLESSLQDALAKLKNRDAKQTVQKHIDLLHTYNEIR-DIALGMIGKVAEHEK 69 KE + DAL+ L+ +D+K + K ++ L N ++ D+ + K AE+ K Sbjct: 3 KETPSKAAADALSDLEIKDSKSNLNKELETLREENRVKSDMLKEKLSKDAENHK 56 >1W7P-D nrPDB Length = 566 Score = 28.5 bits (62), Expect = 0.71, Method: Composition-based stats. Identities = 22/77 (28%), Positives = 33/77 (42%), Gaps = 5/77 (6%) Query: 6 LESRVHLLEQQKEQLESSLQDALAKLKNRDAKQTVQKHIDLLHTYNEIRDIALGMIGKVA 65 L + L E +E E +L + K N D + +DL YN+ I G+I + Sbjct: 402 LNKELFLDEIAREIYEFTLSEF--KDLNSDTNYMIITLVDLYAMYNKSMRIGTGLISPME 459 Query: 66 EHEKCTSVELFDRFGVN 82 E C E F+ G+N Sbjct: 460 MREAC---ERFEHLGLN 473 >1U5T-B nrPDB Length = 169 Score = 28.5 bits (62), Expect = 0.71, Method: Composition-based stats. Identities = 22/77 (28%), Positives = 33/77 (42%), Gaps = 5/77 (6%) Query: 6 LESRVHLLEQQKEQLESSLQDALAKLKNRDAKQTVQKHIDLLHTYNEIRDIALGMIGKVA 65 L + L E +E E +L + K N D + +DL YN+ I G+I + Sbjct: 7 LNKELFLDEIAREIYEFTLSEF--KDLNSDTNYMIITLVDLYAMYNKSMRIGTGLISPME 64 Query: 66 EHEKCTSVELFDRFGVN 82 E C E F+ G+N Sbjct: 65 MREAC---ERFEHLGLN 78 >4AZV-A nrPDB Length = 569 Score = 27.0 bits (58), Expect = 2.0, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 5/36 (13%) Query: 6 LESRVHLLEQQKEQLESSLQDALAKLKNRDAKQTVQ 41 L ++H LEQQ QL+S+ QDA + A+Q V+ Sbjct: 503 LRGQIHTLEQQMAQLQSA-QDAFVE----KAQQPVE 533 >1LDK-A nrPDB Length = 396 Score = 27.0 bits (58), Expect = 2.2, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 8/47 (17%) Query: 7 ESRVHLLEQQKE---QLESSLQDALAKLKNRDAKQT-VQKHIDLLHT 49 ++ LLE+Q+ L S QD LA R +Q ++KH+++ HT Sbjct: 249 KAEARLLEEQRRVQVYLHESTQDELA----RKCEQVLIEKHLEIFHT 291 >3SKS-A nrPDB Length = 567 Score = 27.0 bits (58), Expect = 2.2, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 4/47 (8%) Query: 18 EQLESSLQDALAKLKNRDAKQTVQKHIDLLHTYNEIRDIALGMIGKV 64 E+L+ AL K N +TV++ ++H+ NEIR+ G +G + Sbjct: 17 EELKEKFTVALEKFDN---AKTVEEQKQVIHSINEIRN-DFGTMGNL 59 >1U6G-A nrPDB Length = 776 Score = 25.8 bits (55), Expect = 4.2, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 8/47 (17%) Query: 7 ESRVHLLEQQKE---QLESSLQDALAKLKNRDAKQT-VQKHIDLLHT 49 ++ LLE+Q+ L S QD LA R +Q ++KH+++ HT Sbjct: 263 KAEARLLEEQRRVQVYLHESTQDELA----RKCEQVLIEKHLEIFHT 305 >5L4K-V nrPDB Length = 310 Score = 25.5 bits (54), Expect = 5.7, Method: Composition-based stats. Identities = 11/42 (26%), Positives = 26/42 (61%) Query: 16 QKEQLESSLQDALAKLKNRDAKQTVQKHIDLLHTYNEIRDIA 57 ++E + Q A+ + +D K+ +++H+D+L T N ++ +A Sbjct: 260 EEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLA 301 >5H7W-A nrPDB Length = 529 Score = 25.5 bits (54), Expect = 6.4, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 18/32 (56%) Query: 31 LKNRDAKQTVQKHIDLLHTYNEIRDIALGMIG 62 L+ RD + +QKH D L T + IALG G Sbjct: 166 LEFRDEVEELQKHADKLTTLGVNKIIALGHSG 197 >2CG5-B nrPDB Length = 91 Score = 25.1 bits (53), Expect = 7.8, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 35/61 (57%), Gaps = 4/61 (6%) Query: 2 EKSQLESRVHLL---EQQKEQLESSLQD-ALAKLKNRDAKQTVQKHIDLLHTYNEIRDIA 57 ++ +E+ H+L + L+SSL D L L + + +QT+++ ++L+ + E+R + Sbjct: 8 QRDLVEAVAHILGIRDLAAVNLDSSLADLGLDALMSVEVRQTLERELNLVLSVREVRQLT 67 Query: 58 L 58 L Sbjct: 68 L 68 >5JM5-A nrPDB Length = 332 Score = 24.7 bits (52), Expect = 8.8, Method: Composition-based stats. Identities = 9/25 (36%), Positives = 14/25 (56%) Query: 42 KHIDLLHTYNEIRDIALGMIGKVAE 66 +HID H YN + L + K+A+ Sbjct: 47 RHIDSAHLYNNEEQVGLAIRSKIAD 71 Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta Posted date: Jan 3, 2023 9:05 PM Number of letters in database: 10,336,785 Number of sequences in database: 36,641 Lambda K H 0.313 0.129 0.342 Lambda K H 0.267 0.0401 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,772,448 Number of Sequences: 36641 Number of extensions: 81766 Number of successful extensions: 293 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 18 Number of HSP's that attempted gapping in prelim test: 277 Number of HSP's gapped (non-prelim): 34 length of query: 85 length of database: 10,336,785 effective HSP length: 54 effective length of query: 31 effective length of database: 8,358,171 effective search space: 259103301 effective search space used: 259103301 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 52 (24.7 bits)