BLASTP 2.2.23 [Feb-03-2010] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= Q99278 (115 letters) Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta 36,641 sequences; 10,336,785 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value 5OQM-c nrPDB 233 1e-62 3J1O-H nrPDB 232 3e-62 3R84-A nrPDB 174 8e-45 3FM8-C nrPDB 30 0.27 1VHG-A nrPDB 28 1.1 1TO6-A nrPDB 26 3.0 5Y5Z-N nrPDB 26 3.7 1BG6-A nrPDB 26 4.0 5ZI4-A nrPDB 25 5.3 >5OQM-c nrPDB Length = 115 Score = 233 bits (595), Expect = 1e-62, Method: Compositional matrix adjust. Identities = 115/115 (100%), Positives = 115/115 (100%) Query: 1 MQPPYIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLD 60 MQPPYIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLD Sbjct: 1 MQPPYIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLD 60 Query: 61 KSTTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAILDPSKSK 115 KSTTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAILDPSKSK Sbjct: 61 KSTTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAILDPSKSK 115 >3J1O-H nrPDB Length = 131 Score = 232 bits (592), Expect = 3e-62, Method: Compositional matrix adjust. Identities = 114/114 (100%), Positives = 114/114 (100%) Query: 2 QPPYIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDK 61 QPPYIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDK Sbjct: 18 QPPYIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDK 77 Query: 62 STTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAILDPSKSK 115 STTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAILDPSKSK Sbjct: 78 STTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAILDPSKSK 131 >3R84-A nrPDB Length = 86 Score = 174 bits (441), Expect = 8e-45, Method: Compositional matrix adjust. Identities = 85/85 (100%), Positives = 85/85 (100%) Query: 5 YIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDKSTT 64 YIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDKSTT Sbjct: 2 YIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDKSTT 61 Query: 65 QLRKEIQLLDENVGTRLLPINVNKK 89 QLRKEIQLLDENVGTRLLPINVNKK Sbjct: 62 QLRKEIQLLDENVGTRLLPINVNKK 86 >3FM8-C nrPDB Length = 392 Score = 30.0 bits (66), Expect = 0.27, Method: Composition-based stats. Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Query: 26 EASQVTFIFGELKRGNESVKPQFENHVKQFYERLDKSTTQLRKE 69 E +QV F+ GN++ + +FE+ V FY R S QL +E Sbjct: 84 EEAQVEFM---ASHGNDAARARFESKVPSFYYRPTPSDCQLLRE 124 >1VHG-A nrPDB Length = 198 Score = 27.7 bits (60), Expect = 1.1, Method: Compositional matrix adjust. Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 10/73 (13%) Query: 42 ESVKPQFENHVKQFYERLDKSTTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQ 101 ESV +F N V++ YER+ + + + ++D+++ I + + A+G TE E Sbjct: 27 ESVDLEFSNGVRRVYERMRPTNREAVMIVPIVDDHL------ILIREYAVG--TESYE-- 76 Query: 102 LDLLSAILDPSKS 114 L ++DP +S Sbjct: 77 LGFSKGLIDPGES 89 >1TO6-A nrPDB Length = 371 Score = 26.2 bits (56), Expect = 3.0, Method: Compositional matrix adjust. Identities = 13/59 (22%), Positives = 30/59 (50%), Gaps = 4/59 (6%) Query: 9 RLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDKSTTQLR 67 ++ L D+ + LC T+ FG+ K + ++ + ++ FYE++ +T +L+ Sbjct: 185 HIRILADVVSPLCGH----QGATYTFGKQKGLDSTMFEVVDQAIQDFYEKVSPATLKLK 239 >5Y5Z-N nrPDB Length = 652 Score = 26.2 bits (56), Expect = 3.7, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 19/31 (61%) Query: 81 LLPINVNKKALGQDTEKMEEQLDLLSAILDP 111 L PI + + L + +++EE+L L A L+P Sbjct: 91 LSPIQAHAEGLTRQKQELEEELALAQAYLEP 121 >1BG6-A nrPDB Length = 359 Score = 25.8 bits (55), Expect = 4.0, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 24/36 (66%) Query: 75 ENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAILD 110 E+V T L+P++ +A+ T ++ LDL+S+++D Sbjct: 296 EDVSTGLVPLSELGRAVNVPTPLIDAVLDLISSLID 331 >5ZI4-A nrPDB Length = 345 Score = 25.4 bits (54), Expect = 5.3, Method: Compositional matrix adjust. Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 4/48 (8%) Query: 69 EIQLLD----ENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAILDPS 112 E+ L D E +G L IN N +G D + +E L +L P+ Sbjct: 31 ELALYDIRAAEGIGKDLSHINTNSSCVGYDKDSIENTLSNAQVVLIPA 78 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: 5OQM-c nrPDB 212 3e-56 3J1O-H nrPDB 205 3e-54 3R84-A nrPDB 163 2e-41 Sequences not found previously or not previously below threshold: 3FM8-C nrPDB 31 0.092 1VHG-A nrPDB 29 0.66 5Y5Z-N nrPDB 27 2.3 3NET-A nrPDB 27 2.4 5ZI4-A nrPDB 27 2.6 1BG6-A nrPDB 26 3.1 3S84-A nrPDB 26 3.3 1TO6-A nrPDB 26 3.4 2RCJ-C nrPDB 25 7.7 2PPL-A nrPDB 25 8.5 CONVERGED! >5OQM-c nrPDB Length = 115 Score = 212 bits (539), Expect = 3e-56, Method: Composition-based stats. Identities = 115/115 (100%), Positives = 115/115 (100%) Query: 1 MQPPYIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLD 60 MQPPYIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLD Sbjct: 1 MQPPYIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLD 60 Query: 61 KSTTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAILDPSKSK 115 KSTTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAILDPSKSK Sbjct: 61 KSTTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAILDPSKSK 115 >3J1O-H nrPDB Length = 131 Score = 205 bits (522), Expect = 3e-54, Method: Composition-based stats. Identities = 114/114 (100%), Positives = 114/114 (100%) Query: 2 QPPYIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDK 61 QPPYIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDK Sbjct: 18 QPPYIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDK 77 Query: 62 STTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAILDPSKSK 115 STTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAILDPSKSK Sbjct: 78 STTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAILDPSKSK 131 >3R84-A nrPDB Length = 86 Score = 163 bits (412), Expect = 2e-41, Method: Composition-based stats. Identities = 85/85 (100%), Positives = 85/85 (100%) Query: 5 YIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDKSTT 64 YIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDKSTT Sbjct: 2 YIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDKSTT 61 Query: 65 QLRKEIQLLDENVGTRLLPINVNKK 89 QLRKEIQLLDENVGTRLLPINVNKK Sbjct: 62 QLRKEIQLLDENVGTRLLPINVNKK 86 >3FM8-C nrPDB Length = 392 Score = 31.2 bits (69), Expect = 0.092, Method: Composition-based stats. Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Query: 26 EASQVTFIFGELKRGNESVKPQFENHVKQFYERLDKSTTQLRKE 69 E +QV F+ GN++ + +FE+ V FY R S QL +E Sbjct: 84 EEAQVEFM---ASHGNDAARARFESKVPSFYYRPTPSDCQLLRE 124 >1VHG-A nrPDB Length = 198 Score = 28.5 bits (62), Expect = 0.66, Method: Composition-based stats. Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 10/73 (13%) Query: 42 ESVKPQFENHVKQFYERLDKSTTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQ 101 ESV +F N V++ YER+ + + + ++D+++ I + + A+G TE E Sbjct: 27 ESVDLEFSNGVRRVYERMRPTNREAVMIVPIVDDHL------ILIREYAVG--TESYE-- 76 Query: 102 LDLLSAILDPSKS 114 L ++DP +S Sbjct: 77 LGFSKGLIDPGES 89 >5Y5Z-N nrPDB Length = 652 Score = 26.6 bits (57), Expect = 2.3, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 19/31 (61%) Query: 81 LLPINVNKKALGQDTEKMEEQLDLLSAILDP 111 L PI + + L + +++EE+L L A L+P Sbjct: 91 LSPIQAHAEGLTRQKQELEEELALAQAYLEP 121 >3NET-A nrPDB Length = 465 Score = 26.6 bits (57), Expect = 2.4, Method: Composition-based stats. Identities = 18/83 (21%), Positives = 43/83 (51%), Gaps = 4/83 (4%) Query: 25 QEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDKSTTQLRKEIQLLD--ENVGTRLL 82 Q + +T IF + G+ ++ + F++ L+ S TQ++ I ++D E +G + Sbjct: 163 QMPAIITEIFEAVNIGDFVIRINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKV 222 Query: 83 PINVNKKALGQDTEKMEEQLDLL 105 + + K+ G + E+ ++ +D + Sbjct: 223 KLELEKE--GINPEQTQKIIDFV 243 >5ZI4-A nrPDB Length = 345 Score = 26.6 bits (57), Expect = 2.6, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 4/48 (8%) Query: 69 EIQLLD----ENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAILDPS 112 E+ L D E +G L IN N +G D + +E L +L P+ Sbjct: 31 ELALYDIRAAEGIGKDLSHINTNSSCVGYDKDSIENTLSNAQVVLIPA 78 >1BG6-A nrPDB Length = 359 Score = 26.2 bits (56), Expect = 3.1, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 24/36 (66%) Query: 75 ENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAILD 110 E+V T L+P++ +A+ T ++ LDL+S+++D Sbjct: 296 EDVSTGLVPLSELGRAVNVPTPLIDAVLDLISSLID 331 >3S84-A nrPDB Length = 273 Score = 26.2 bits (56), Expect = 3.3, Method: Composition-based stats. Identities = 15/51 (29%), Positives = 31/51 (60%), Gaps = 1/51 (1%) Query: 54 QFYERLDKSTTQLRKEIQLLDENVGTRLLP-INVNKKALGQDTEKMEEQLD 103 + +ERL K + +L++EI E + RLLP N + +G + +++++L+ Sbjct: 4 ELHERLAKDSEKLKEEIGKELEELRARLLPHANEVSQKIGDNLRELQQRLE 54 >1TO6-A nrPDB Length = 371 Score = 26.2 bits (56), Expect = 3.4, Method: Composition-based stats. Identities = 13/58 (22%), Positives = 30/58 (51%), Gaps = 4/58 (6%) Query: 10 LKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDKSTTQLR 67 ++ L D+ + LC T+ FG+ K + ++ + ++ FYE++ +T +L+ Sbjct: 186 IRILADVVSPLCGH----QGATYTFGKQKGLDSTMFEVVDQAIQDFYEKVSPATLKLK 239 >2RCJ-C nrPDB Length = 523 Score = 25.1 bits (53), Expect = 7.7, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 17/38 (44%) Query: 78 GTRLLPINVNKKALGQDTEKMEEQLDLLSAILDPSKSK 115 GT+ NVN K +K E L L S L P K K Sbjct: 291 GTQTYICNVNHKPSNTKVDKRVEPLSLPSVFLFPPKPK 328 >2PPL-A nrPDB Length = 485 Score = 24.7 bits (52), Expect = 8.5, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 20/36 (55%) Query: 18 TQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVK 53 T +C L E +V I + K+G+++ Q N+V+ Sbjct: 114 TDMCKKLFEVEEVNCICVDWKKGSQATYTQAANNVR 149 Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta Posted date: Jan 3, 2023 9:05 PM Number of letters in database: 10,336,785 Number of sequences in database: 36,641 Lambda K H 0.313 0.131 0.349 Lambda K H 0.267 0.0406 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,010,166 Number of Sequences: 36641 Number of extensions: 134856 Number of successful extensions: 358 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 25 Number of HSP's that attempted gapping in prelim test: 330 Number of HSP's gapped (non-prelim): 53 length of query: 115 length of database: 10,336,785 effective HSP length: 80 effective length of query: 35 effective length of database: 7,405,505 effective search space: 259192675 effective search space used: 259192675 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 52 (24.7 bits)