BLASTP 2.2.23 [Feb-03-2010] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= Q3E833 (88 letters) Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta 36,641 sequences; 10,336,785 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value 4WXA-A nrPDB 176 2e-45 4M00-A nrPDB 25 8.8 2RHH-A nrPDB 25 9.7 >4WXA-A nrPDB Length = 94 Score = 176 bits (445), Expect = 2e-45, Method: Compositional matrix adjust. Identities = 88/88 (100%), Positives = 88/88 (100%) Query: 1 MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS 60 MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS Sbjct: 1 MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS 60 Query: 61 IDDRVLRVGVSSIIDSIKTIVEAMDVLS 88 IDDRVLRVGVSSIIDSIKTIVEAMDVLS Sbjct: 61 IDDRVLRVGVSSIIDSIKTIVEAMDVLS 88 >4M00-A nrPDB Length = 541 Score = 24.6 bits (52), Expect = 8.8, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 22/38 (57%), Gaps = 6/38 (15%) Query: 41 QDFQVDYSSEKNVMLVQF------RSIDDRVLRVGVSS 72 QDF ++Y+ + VM V++ R+I D + + G ++ Sbjct: 219 QDFDINYNGDTKVMTVKYAGQTWTRNISDWIAKSGTTN 256 >2RHH-A nrPDB Length = 325 Score = 24.6 bits (52), Expect = 9.7, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 37 ILKPQDFQVDYSSEKNVMLVQFRSIDDRVLRVGVSSIIDSIKT 79 I+ P D ++ + ML FR D+ VLR GV I D I T Sbjct: 152 IVIPNDRILEIVDKNTPMLEAFREADN-VLRQGVQGISDLIAT 193 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: 4WXA-A nrPDB 162 2e-41 Sequences not found previously or not previously below threshold: 2RHH-A nrPDB 27 2.8 2VXY-A nrPDB 26 3.1 4CFH-A nrPDB 26 3.5 4M00-A nrPDB 26 3.9 CONVERGED! >4WXA-A nrPDB Length = 94 Score = 162 bits (411), Expect = 2e-41, Method: Composition-based stats. Identities = 88/88 (100%), Positives = 88/88 (100%) Query: 1 MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS 60 MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS Sbjct: 1 MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS 60 Query: 61 IDDRVLRVGVSSIIDSIKTIVEAMDVLS 88 IDDRVLRVGVSSIIDSIKTIVEAMDVLS Sbjct: 61 IDDRVLRVGVSSIIDSIKTIVEAMDVLS 88 >2RHH-A nrPDB Length = 325 Score = 26.6 bits (57), Expect = 2.8, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 37 ILKPQDFQVDYSSEKNVMLVQFRSIDDRVLRVGVSSIIDSIKT 79 I+ P D ++ + ML FR D+ VLR GV I D I T Sbjct: 152 IVIPNDRILEIVDKNTPMLEAFREADN-VLRQGVQGISDLIAT 193 >2VXY-A nrPDB Length = 382 Score = 26.2 bits (56), Expect = 3.1, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 37 ILKPQDFQVDYSSEKNVMLVQFRSIDDRVLRVGVSSIIDSIKT 79 I+ P D ++ + ML FR D+ VLR GV I D I T Sbjct: 162 IVIPNDRILEIVDKNTPMLEAFREADN-VLRQGVQGISDLIAT 203 >4CFH-A nrPDB Length = 493 Score = 26.2 bits (56), Expect = 3.5, Method: Composition-based stats. Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 8/63 (12%) Query: 7 KSLDHTLELKIPFETE-RQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRSIDDRV 65 K LD+ ++ P+ R+ T S + Q +QVD L+ FRSIDD + Sbjct: 437 KQLDYEWKVVNPYYLRVRRKNPVTSTFSK---MSLQLYQVD----SRTYLLDFRSIDDEI 489 Query: 66 LRV 68 L V Sbjct: 490 LEV 492 >4M00-A nrPDB Length = 541 Score = 25.8 bits (55), Expect = 3.9, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 22/38 (57%), Gaps = 6/38 (15%) Query: 41 QDFQVDYSSEKNVMLVQF------RSIDDRVLRVGVSS 72 QDF ++Y+ + VM V++ R+I D + + G ++ Sbjct: 219 QDFDINYNGDTKVMTVKYAGQTWTRNISDWIAKSGTTN 256 Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta Posted date: Jan 3, 2023 9:05 PM Number of letters in database: 10,336,785 Number of sequences in database: 36,641 Lambda K H 0.316 0.132 0.344 Lambda K H 0.267 0.0409 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,787,797 Number of Sequences: 36641 Number of extensions: 82656 Number of successful extensions: 191 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 7 Number of HSP's that attempted gapping in prelim test: 186 Number of HSP's gapped (non-prelim): 12 length of query: 88 length of database: 10,336,785 effective HSP length: 57 effective length of query: 31 effective length of database: 8,248,248 effective search space: 255695688 effective search space used: 255695688 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)