BLASTP 2.2.23 [Feb-03-2010] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= Q14061 (63 letters) Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta 36,641 sequences; 10,336,785 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value 2RNB-A nrPDB 128 7e-31 2L0Y-B nrPDB 120 9e-29 1U97-A nrPDB 46 3e-06 4N59-A nrPDB 27 1.8 5J3U-A nrPDB 26 4.5 1UAP-A nrPDB 26 4.9 2UWF-A nrPDB 25 7.5 3PFN-A nrPDB 25 9.2 >2RNB-A nrPDB Length = 67 Score = 128 bits (321), Expect = 7e-31, Method: Compositional matrix adjust. Identities = 63/63 (100%), Positives = 63/63 (100%) Query: 1 MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALG 60 MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALG Sbjct: 5 MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALG 64 Query: 61 FKI 63 FKI Sbjct: 65 FKI 67 >2L0Y-B nrPDB Length = 67 Score = 120 bits (302), Expect = 9e-29, Method: Compositional matrix adjust. Identities = 59/63 (93%), Positives = 60/63 (95%) Query: 1 MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALG 60 MPGLVDSNPA PESQEK+PLKPCC CPETKKARDACIIEKGEEHCGHLIEAHKE MRALG Sbjct: 5 MPGLVDSNPALPESQEKRPLKPCCTCPETKKARDACIIEKGEEHCGHLIEAHKESMRALG 64 Query: 61 FKI 63 FKI Sbjct: 65 FKI 67 >1U97-A nrPDB Length = 69 Score = 46.2 bits (108), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 3/50 (6%) Query: 16 EKKPLKPCCACPETKKARDACIIEKGE--EHCGHLIEAHKECMRALGFKI 63 E KP KPCC C K+ RD CI+ G+ E C IE +KECM+ GF++ Sbjct: 17 EDKP-KPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEV 65 >4N59-A nrPDB Length = 279 Score = 26.9 bits (58), Expect = 1.8, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 5/31 (16%) Query: 13 ESQEKKPLKPCCACPETKKARDACIIEKGEE 43 E QEKK + CC+ P++ C IE G E Sbjct: 65 EKQEKKYILTCCSYPKSD-----CTIETGYE 90 >5J3U-A nrPDB Length = 261 Score = 25.8 bits (55), Expect = 4.5, Method: Composition-based stats. Identities = 13/46 (28%), Positives = 21/46 (45%) Query: 15 QEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALG 60 QEKK C E I++ GE +C LI+ + ++ +G Sbjct: 38 QEKKIEASTCLIREGDDGECLYIVQSGELNCSKLIDGEERVVKVVG 83 >1UAP-A nrPDB Length = 154 Score = 25.8 bits (55), Expect = 4.9, Method: Compositional matrix adjust. Identities = 13/41 (31%), Positives = 20/41 (48%) Query: 9 PAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLI 49 P+PP K PC CP KK ++ + EE+ G ++ Sbjct: 84 PSPPTGASLKFYVPCKQCPPMKKGVSYLLMGQVEENRGPVL 124 >2UWF-A nrPDB Length = 356 Score = 25.0 bits (53), Expect = 7.5, Method: Composition-based stats. Identities = 9/28 (32%), Positives = 17/28 (60%) Query: 27 PETKKARDACIIEKGEEHCGHLIEAHKE 54 PE +KA ++E+ E H ++E +K+ Sbjct: 112 PEKRKANKQLLLERMENHIKTVVERYKD 139 >3PFN-A nrPDB Length = 365 Score = 24.6 bits (52), Expect = 9.2, Method: Composition-based stats. Identities = 10/21 (47%), Positives = 15/21 (71%) Query: 30 KKARDACIIEKGEEHCGHLIE 50 KK RDA +++ +E C HL+E Sbjct: 45 KKMRDASLLQPFKELCTHLME 65 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: 2L0Y-B nrPDB 102 3e-23 2RNB-A nrPDB 100 2e-22 1U97-A nrPDB 57 1e-09 Sequences not found previously or not previously below threshold: CONVERGED! >2L0Y-B nrPDB Length = 67 Score = 102 bits (254), Expect = 3e-23, Method: Composition-based stats. Identities = 59/63 (93%), Positives = 60/63 (95%) Query: 1 MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALG 60 MPGLVDSNPA PESQEK+PLKPCC CPETKKARDACIIEKGEEHCGHLIEAHKE MRALG Sbjct: 5 MPGLVDSNPALPESQEKRPLKPCCTCPETKKARDACIIEKGEEHCGHLIEAHKESMRALG 64 Query: 61 FKI 63 FKI Sbjct: 65 FKI 67 >2RNB-A nrPDB Length = 67 Score = 100 bits (248), Expect = 2e-22, Method: Composition-based stats. Identities = 63/63 (100%), Positives = 63/63 (100%) Query: 1 MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALG 60 MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALG Sbjct: 5 MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALG 64 Query: 61 FKI 63 FKI Sbjct: 65 FKI 67 >1U97-A nrPDB Length = 69 Score = 57.4 bits (137), Expect = 1e-09, Method: Composition-based stats. Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 3/50 (6%) Query: 16 EKKPLKPCCACPETKKARDACIIEKGE--EHCGHLIEAHKECMRALGFKI 63 E KP KPCC C K+ RD CI+ G+ E C IE +KECM+ GF++ Sbjct: 17 EDKP-KPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEV 65 Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta Posted date: Jan 3, 2023 9:05 PM Number of letters in database: 10,336,785 Number of sequences in database: 36,641 Lambda K H 0.307 0.137 0.432 Lambda K H 0.267 0.0406 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,716,857 Number of Sequences: 36641 Number of extensions: 81243 Number of successful extensions: 141 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 121 Number of HSP's gapped (non-prelim): 21 length of query: 63 length of database: 10,336,785 effective HSP length: 35 effective length of query: 28 effective length of database: 9,054,350 effective search space: 253521800 effective search space used: 253521800 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.1 bits) S2: 52 (24.7 bits)