BLASTP 2.2.23 [Feb-03-2010] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= Q12287 (69 letters) Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta 36,641 sequences; 10,336,785 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value 1U97-A nrPDB 139 4e-34 2RNB-A nrPDB 46 3e-06 2L0Y-B nrPDB 43 3e-05 2QG7-A nrPDB 27 2.1 3B9O-A nrPDB 26 4.1 6M9T-A nrPDB 26 4.5 2LQT-A nrPDB 25 6.8 5FIR-A nrPDB 25 8.0 1YD8-G nrPDB 25 9.1 6BWF-A nrPDB 25 9.5 >1U97-A nrPDB Length = 69 Score = 139 bits (349), Expect = 4e-34, Method: Compositional matrix adjust. Identities = 69/69 (100%), Positives = 69/69 (100%) Query: 1 MTETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKG 60 MTETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKG Sbjct: 1 MTETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKG 60 Query: 61 YGFEVPSAN 69 YGFEVPSAN Sbjct: 61 YGFEVPSAN 69 >2RNB-A nrPDB Length = 67 Score = 46.2 bits (108), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 3/50 (6%) Query: 17 EDKP-KPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEV 65 E KP KPCC C K+ RD CI+ G+ E C IE +KECM+ GF++ Sbjct: 20 EKKPLKPCCACPETKKARDACIIEKGE--EHCGHLIEAHKECMRALGFKI 67 >2L0Y-B nrPDB Length = 67 Score = 43.1 bits (100), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Query: 21 KPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEV 65 KPCC C K+ RD CI+ G+ E C IE +KE M+ GF++ Sbjct: 25 KPCCTCPETKKARDACIIEKGE--EHCGHLIEAHKESMRALGFKI 67 >2QG7-A nrPDB Length = 458 Score = 26.9 bits (58), Expect = 2.1, Method: Compositional matrix adjust. Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Query: 20 PKPCCVCKPEKEERDTCILFNGQDSEKCKEFIE--KYKECMKGYGF 63 PK + E+E++ +CIL+N ++K F + +E M GY Sbjct: 143 PKTDEIINREREKKISCILYNKNIAKKIYVFFTNGRIEEFMDGYAL 188 >3B9O-A nrPDB Length = 440 Score = 25.8 bits (55), Expect = 4.1, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 3/57 (5%) Query: 2 TETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECM 58 T+ K E + + + P P +C+P + T +++ SE+ +EF K+ EC+ Sbjct: 191 TDPSKVHEINHSGKYFEVPGPH-LCEPSPQR--TPVIYQAGMSERGREFAAKHAECV 244 Score = 24.6 bits (52), Expect = 9.8, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 15/27 (55%) Query: 36 CILFNGQDSEKCKEFIEKYKECMKGYG 62 C+ G+D E K F++ ++ K YG Sbjct: 243 CVFLGGKDVETLKFFVDDIRKRAKKYG 269 >6M9T-A nrPDB Length = 537 Score = 25.8 bits (55), Expect = 4.5, Method: Composition-based stats. Identities = 10/21 (47%), Positives = 12/21 (57%) Query: 37 ILFNGQDSEKCKEFIEKYKEC 57 ++FN E CK EK KEC Sbjct: 468 MIFNQTSVEHCKTHTEKQKEC 488 >2LQT-A nrPDB Length = 85 Score = 25.0 bits (53), Expect = 6.8, Method: Compositional matrix adjust. Identities = 11/40 (27%), Positives = 18/40 (45%) Query: 26 CKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEV 65 C E + C+ N D E+C + +YK C + + V Sbjct: 16 CLSESDASTRCLDENNYDRERCSTYFLRYKNCRRFWNSIV 55 >5FIR-A nrPDB Length = 636 Score = 25.0 bits (53), Expect = 8.0, Method: Composition-based stats. Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 12 NHAECEDKPKPCCVC 26 NH EC+D P C +C Sbjct: 615 NHDECQDLPTNCGIC 629 >1YD8-G nrPDB Length = 98 Score = 24.6 bits (52), Expect = 9.1, Method: Compositional matrix adjust. Identities = 14/59 (23%), Positives = 27/59 (45%) Query: 2 TETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKG 60 ++ D++ +E +CE+K + E E+ D + Q S+ I YK ++G Sbjct: 38 SDGDRELMKELFDQCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTIIEG 96 >6BWF-A nrPDB Length = 954 Score = 24.6 bits (52), Expect = 9.5, Method: Composition-based stats. Identities = 12/42 (28%), Positives = 23/42 (54%), Gaps = 6/42 (14%) Query: 23 CCVCKPEKEERDT---CILFNGQDSEKCKEFIEKYKECMKGY 61 CCVCK K+++ + + +D +K +F E +C++ Y Sbjct: 797 CCVCKRRKKDKTSDGPKLFLTEEDQKKLHDFEE---QCVEMY 835 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: 1U97-A nrPDB 86 3e-18 2L0Y-B nrPDB 66 3e-12 2RNB-A nrPDB 65 7e-12 Sequences not found previously or not previously below threshold: 5VA1-A nrPDB 29 0.71 4ZXB-E nrPDB 27 2.2 6M9T-A nrPDB 27 2.4 2LQT-A nrPDB 27 2.5 CONVERGED! >1U97-A nrPDB Length = 69 Score = 85.9 bits (211), Expect = 3e-18, Method: Composition-based stats. Identities = 69/69 (100%), Positives = 69/69 (100%) Query: 1 MTETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKG 60 MTETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKG Sbjct: 1 MTETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKG 60 Query: 61 YGFEVPSAN 69 YGFEVPSAN Sbjct: 61 YGFEVPSAN 69 >2L0Y-B nrPDB Length = 67 Score = 65.9 bits (159), Expect = 3e-12, Method: Composition-based stats. Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 3/50 (6%) Query: 17 EDKP-KPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEV 65 E +P KPCC C K+ RD CI+ G+ E C IE +KE M+ GF++ Sbjct: 20 EKRPLKPCCTCPETKKARDACIIEKGE--EHCGHLIEAHKESMRALGFKI 67 >2RNB-A nrPDB Length = 67 Score = 65.1 bits (157), Expect = 7e-12, Method: Composition-based stats. Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 3/50 (6%) Query: 17 EDKP-KPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEV 65 E KP KPCC C K+ RD CI+ G+ E C IE +KECM+ GF++ Sbjct: 20 EKKPLKPCCACPETKKARDACIIEKGE--EHCGHLIEAHKECMRALGFKI 67 >5VA1-A nrPDB Length = 795 Score = 28.5 bits (62), Expect = 0.71, Method: Composition-based stats. Identities = 10/42 (23%), Positives = 18/42 (42%) Query: 28 PEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEVPSAN 69 PE + D C+ N + CK F K C++ + + + Sbjct: 481 PECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKTTH 522 >4ZXB-E nrPDB Length = 894 Score = 26.6 bits (57), Expect = 2.2, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Query: 9 EQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDS 44 ++ N +E ED CC C D+ IL ++S Sbjct: 668 QKHNQSEYEDSAGECCSCPKT----DSQILKELEES 699 >6M9T-A nrPDB Length = 537 Score = 26.6 bits (57), Expect = 2.4, Method: Composition-based stats. Identities = 10/21 (47%), Positives = 12/21 (57%) Query: 37 ILFNGQDSEKCKEFIEKYKEC 57 ++FN E CK EK KEC Sbjct: 468 MIFNQTSVEHCKTHTEKQKEC 488 >2LQT-A nrPDB Length = 85 Score = 26.6 bits (57), Expect = 2.5, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 16/34 (47%) Query: 26 CKPEKEERDTCILFNGQDSEKCKEFIEKYKECMK 59 C E + C+ N D E+C + +YK C + Sbjct: 16 CLSESDASTRCLDENNYDRERCSTYFLRYKNCRR 49 Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta Posted date: Jan 3, 2023 9:05 PM Number of letters in database: 10,336,785 Number of sequences in database: 36,641 Lambda K H 0.308 0.129 0.389 Lambda K H 0.267 0.0394 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,829,550 Number of Sequences: 36641 Number of extensions: 92506 Number of successful extensions: 183 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 159 Number of HSP's gapped (non-prelim): 24 length of query: 69 length of database: 10,336,785 effective HSP length: 40 effective length of query: 29 effective length of database: 8,871,145 effective search space: 257263205 effective search space used: 257263205 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits) S2: 52 (24.7 bits)