BLASTP 2.2.23 [Feb-03-2010] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= Q03818 (150 letters) Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta 36,641 sequences; 10,336,785 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value 3A7P-A nrPDB 292 5e-80 4AC0-A nrPDB 29 0.68 5YZ0-C nrPDB 29 0.80 6G72-h nrPDB 27 3.2 2Y53-A nrPDB 27 5.0 3WVS-A nrPDB 26 6.1 5Y6P-a2 nrPDB 26 6.3 4W6M-A nrPDB 26 8.4 4N06-A nrPDB 25 9.7 >3A7P-A nrPDB Length = 152 Score = 292 bits (747), Expect = 5e-80, Method: Compositional matrix adjust. Identities = 148/150 (98%), Positives = 148/150 (98%) Query: 1 MGNFIITERKKAKEERSNPQTDSMDDLLIRRLTDRNDKEAHLNELFQDNSGAIGGNIVSH 60 MGNFIITERKKAKEERSNPQTDSMDDLLIRRLTDRNDKEAHLNELFQDNSGAIGGNIVSH Sbjct: 3 MGNFIITERKKAKEERSNPQTDSMDDLLIRRLTDRNDKEAHLNELFQDNSGAIGGNIVSH 62 Query: 61 DDALLNTLAILQKELKSKEQEIRRLKEVIALKNKNTERLNDELISGTIENNVLQQKLSDL 120 DDALLNTLAILQKELKSKEQEIRRLKEVIALKNKNTERLN LISGTIENNVLQQKLSDL Sbjct: 63 DDALLNTLAILQKELKSKEQEIRRLKEVIALKNKNTERLNAALISGTIENNVLQQKLSDL 122 Query: 121 KKEHSQLVARWLKKTEKETEAMNSEIDGTK 150 KKEHSQLVARWLKKTEKETEAMNSEIDGTK Sbjct: 123 KKEHSQLVARWLKKTEKETEAMNSEIDGTK 152 >4AC0-A nrPDB Length = 202 Score = 29.3 bits (64), Expect = 0.68, Method: Compositional matrix adjust. Identities = 13/21 (61%), Positives = 14/21 (66%) Query: 8 ERKKAKEERSNPQTDSMDDLL 28 E + AKEER P TDSM LL Sbjct: 149 EHQVAKEERETPTTDSMPPLL 169 >5YZ0-C nrPDB Length = 791 Score = 28.9 bits (63), Expect = 0.80, Method: Composition-based stats. Identities = 20/81 (24%), Positives = 47/81 (58%), Gaps = 4/81 (4%) Query: 68 LAILQKELKSKEQEIRRLKEVIALKNKNTERLNDELISGTIENNVLQQKLSD--LKKEHS 125 L +LQ + K +++++ ++E + +KN + L D L E+ + +Q+ S L++E + Sbjct: 114 LEVLQAQYKELKEKMKVMEEEVLIKNGEIKILRDSL--HQTESVLEEQRRSHFLLEQEKT 171 Query: 126 QLVARWLKKTEKETEAMNSEI 146 Q ++ K+ K+ +++ SE+ Sbjct: 172 QALSDKEKEFSKKLQSLQSEL 192 >6G72-h nrPDB Length = 189 Score = 26.9 bits (58), Expect = 3.2, Method: Compositional matrix adjust. Identities = 15/24 (62%), Positives = 17/24 (70%), Gaps = 5/24 (20%) Query: 67 TLAILQ-----KELKSKEQEIRRL 85 TLAILQ EL+ KEQE+RRL Sbjct: 136 TLAILQIESEKAELRLKEQEVRRL 159 >2Y53-A nrPDB Length = 534 Score = 26.6 bits (57), Expect = 5.0, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Query: 30 RRLTDRND-KEAHLNELFQDNSGAIGGNIVSHDDALLNTLAI 70 R TD N EAH L + G++ +I S+DDA L LA+ Sbjct: 415 RVTTDTNALPEAHAVALARRGQGSLVASIYSNDDAHLGRLAL 456 >3WVS-A nrPDB Length = 401 Score = 26.2 bits (56), Expect = 6.1, Method: Compositional matrix adjust. Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 4/59 (6%) Query: 62 DALLNTLAILQKELKSKEQE-IRRLKEVIALKNKNTERLNDELISGTIENNVLQQKLSD 119 DA+L+T + +E + K E + + +IA + D+LISG IE +Q KL++ Sbjct: 173 DAILSTSTLNPEEGRVKRMELVGYIGGIIAARRAQP---ADDLISGMIEARDVQDKLTE 228 >5Y6P-a2 nrPDB Length = 885 Score = 26.2 bits (56), Expect = 6.3, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Query: 69 AILQKELKSKEQEIRRLKEVIALKNKNTERLNDELISGTIENN 111 AI+Q E + + ++ L E++A N ++RL I+ I NN Sbjct: 24 AIMQAEQQDRFLQLGELNEIVAFLNSGSKRLE---IANVISNN 63 >4W6M-A nrPDB Length = 236 Score = 25.8 bits (55), Expect = 8.4, Method: Compositional matrix adjust. Identities = 17/54 (31%), Positives = 25/54 (46%) Query: 37 DKEAHLNELFQDNSGAIGGNIVSHDDALLNTLAILQKELKSKEQEIRRLKEVIA 90 D L + +Q N+ G + DD L+T IL K+L K + L+ V A Sbjct: 173 DGSVQLADHYQQNTPIGDGPVDLPDDHYLSTQTILSKDLNEKRDHMVLLEYVTA 226 >4N06-A nrPDB Length = 347 Score = 25.4 bits (54), Expect = 9.7, Method: Compositional matrix adjust. Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Query: 84 RLKEVIALKNKNTERLNDELISGTIENNV-LQQKLSDLKKEHSQLVARWLKKTEKETEAM 142 R ++ +A +K L E I + N + + L+ +K+ + VA L K +KE +A Sbjct: 88 RREQYLAYGDKRGVHLAKEFIKAKMANQMAILTNLAKARKDSNPEVAESLLKAKKEIDAC 147 Query: 143 NSEIDGT 149 +E+DG Sbjct: 148 LNELDGV 154 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: 3A7P-A nrPDB 231 8e-62 Sequences not found previously or not previously below threshold: 5YZ0-C nrPDB 30 0.36 3JAX-A nrPDB 29 0.88 6G72-h nrPDB 28 1.2 4AC0-A nrPDB 28 1.5 5Y6P-a2 nrPDB 27 2.8 2Y53-A nrPDB 27 3.4 3K7D-A nrPDB 26 5.5 4QTS-A nrPDB 26 8.6 4R3Z-A nrPDB 25 9.2 4RSI-B nrPDB 25 9.9 CONVERGED! >3A7P-A nrPDB Length = 152 Score = 231 bits (590), Expect = 8e-62, Method: Composition-based stats. Identities = 148/150 (98%), Positives = 148/150 (98%) Query: 1 MGNFIITERKKAKEERSNPQTDSMDDLLIRRLTDRNDKEAHLNELFQDNSGAIGGNIVSH 60 MGNFIITERKKAKEERSNPQTDSMDDLLIRRLTDRNDKEAHLNELFQDNSGAIGGNIVSH Sbjct: 3 MGNFIITERKKAKEERSNPQTDSMDDLLIRRLTDRNDKEAHLNELFQDNSGAIGGNIVSH 62 Query: 61 DDALLNTLAILQKELKSKEQEIRRLKEVIALKNKNTERLNDELISGTIENNVLQQKLSDL 120 DDALLNTLAILQKELKSKEQEIRRLKEVIALKNKNTERLN LISGTIENNVLQQKLSDL Sbjct: 63 DDALLNTLAILQKELKSKEQEIRRLKEVIALKNKNTERLNAALISGTIENNVLQQKLSDL 122 Query: 121 KKEHSQLVARWLKKTEKETEAMNSEIDGTK 150 KKEHSQLVARWLKKTEKETEAMNSEIDGTK Sbjct: 123 KKEHSQLVARWLKKTEKETEAMNSEIDGTK 152 >5YZ0-C nrPDB Length = 791 Score = 30.4 bits (67), Expect = 0.36, Method: Composition-based stats. Identities = 20/81 (24%), Positives = 47/81 (58%), Gaps = 4/81 (4%) Query: 68 LAILQKELKSKEQEIRRLKEVIALKNKNTERLNDELISGTIENNVLQQKLSD--LKKEHS 125 L +LQ + K +++++ ++E + +KN + L D L E+ + +Q+ S L++E + Sbjct: 114 LEVLQAQYKELKEKMKVMEEEVLIKNGEIKILRDSL--HQTESVLEEQRRSHFLLEQEKT 171 Query: 126 QLVARWLKKTEKETEAMNSEI 146 Q ++ K+ K+ +++ SE+ Sbjct: 172 QALSDKEKEFSKKLQSLQSEL 192 >3JAX-A nrPDB Length = 974 Score = 28.8 bits (63), Expect = 0.88, Method: Composition-based stats. Identities = 25/95 (26%), Positives = 43/95 (45%), Gaps = 16/95 (16%) Query: 72 QKELKSKEQEIRRLKEVIALKNKNTERLNDELISGTIENNVLQ--------------QKL 117 +KE+ S ++E RLKE + + L ++++S E N LQ ++ Sbjct: 857 EKEMASMKEEFTRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERC 916 Query: 118 SDLKKEHSQLVARWLKKTEK--ETEAMNSEIDGTK 150 L K QL A+ + E+ + E MN+E+ K Sbjct: 917 DQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKK 951 >6G72-h nrPDB Length = 189 Score = 28.5 bits (62), Expect = 1.2, Method: Composition-based stats. Identities = 15/24 (62%), Positives = 17/24 (70%), Gaps = 5/24 (20%) Query: 67 TLAILQ-----KELKSKEQEIRRL 85 TLAILQ EL+ KEQE+RRL Sbjct: 136 TLAILQIESEKAELRLKEQEVRRL 159 >4AC0-A nrPDB Length = 202 Score = 28.1 bits (61), Expect = 1.5, Method: Composition-based stats. Identities = 13/21 (61%), Positives = 14/21 (66%) Query: 8 ERKKAKEERSNPQTDSMDDLL 28 E + AKEER P TDSM LL Sbjct: 149 EHQVAKEERETPTTDSMPPLL 169 >5Y6P-a2 nrPDB Length = 885 Score = 27.3 bits (59), Expect = 2.8, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Query: 69 AILQKELKSKEQEIRRLKEVIALKNKNTERLNDELISGTIENN 111 AI+Q E + + ++ L E++A N ++RL I+ I NN Sbjct: 24 AIMQAEQQDRFLQLGELNEIVAFLNSGSKRLE---IANVISNN 63 >2Y53-A nrPDB Length = 534 Score = 26.9 bits (58), Expect = 3.4, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Query: 30 RRLTDRND-KEAHLNELFQDNSGAIGGNIVSHDDALLNTLAI 70 R TD N EAH L + G++ +I S+DDA L LA+ Sbjct: 415 RVTTDTNALPEAHAVALARRGQGSLVASIYSNDDAHLGRLAL 456 >3K7D-A nrPDB Length = 498 Score = 26.1 bits (56), Expect = 5.5, Method: Composition-based stats. Identities = 19/78 (24%), Positives = 39/78 (50%), Gaps = 3/78 (3%) Query: 57 IVSHDDALLNTLAILQKELKSKEQEIRRLKEVIA--LKNKNTERLNDELISGTIENNVLQ 114 + +H DA+ + L +E K+ + E+R ++E + L NK+ +R + + G I + Sbjct: 351 LTAHFDAVRREIMTLPREGKTLQTEVREMREKMRAHLGNKHRDRFDIKADEGGITDIEFI 410 Query: 115 QKLSDLKKEHSQ-LVARW 131 + L+ H + + RW Sbjct: 411 TQYLVLRYAHEKPKLTRW 428 >4QTS-A nrPDB Length = 376 Score = 25.8 bits (55), Expect = 8.6, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 25/53 (47%) Query: 71 LQKELKSKEQEIRRLKEVIALKNKNTERLNDELISGTIENNVLQQKLSDLKKE 123 + K + E+EI +K + +K + + LIS +E V +L D+ E Sbjct: 131 INKSIVISEKEIEEIKRIFGIKAEKLKHAKISLISKHLEQKVAIDRLKDITLE 183 >4R3Z-A nrPDB Length = 312 Score = 25.4 bits (54), Expect = 9.2, Method: Composition-based stats. Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 4/52 (7%) Query: 63 ALLNTLAILQKELKSKEQEIRRLKEVIALKNKNTERLNDELISGTIENNVLQ 114 +LL AILQ L+ E ++L+ A K E L ELI I+N V Q Sbjct: 30 SLLKEKAILQATLR----EEKKLRVENAKLKKEIEELKQELIQAEIQNGVKQ 77 >4RSI-B nrPDB Length = 397 Score = 25.4 bits (54), Expect = 9.9, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 30/56 (53%) Query: 72 QKELKSKEQEIRRLKEVIALKNKNTERLNDELISGTIENNVLQQKLSDLKKEHSQL 127 + +++ E E+ L+E A KN E L +++++ LQ + DLKK+ + L Sbjct: 15 ESQIQLAESELSLLEETQAKLKKNVETLEEKILAKKTHKQELQDLILDLKKKLNSL 70 Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta Posted date: Jan 3, 2023 9:05 PM Number of letters in database: 10,336,785 Number of sequences in database: 36,641 Lambda K H 0.311 0.137 0.373 Lambda K H 0.267 0.0399 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,169,878 Number of Sequences: 36641 Number of extensions: 179727 Number of successful extensions: 645 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 66 Number of HSP's that attempted gapping in prelim test: 602 Number of HSP's gapped (non-prelim): 110 length of query: 150 length of database: 10,336,785 effective HSP length: 88 effective length of query: 62 effective length of database: 7,112,377 effective search space: 440967374 effective search space used: 440967374 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 54 (25.4 bits)