BLASTP 2.2.23 [Feb-03-2010] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= Q01519 (83 letters) Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta 36,641 sequences; 10,336,785 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value 6GIQ-j nrPDB 178 5e-46 1V54-H nrPDB 85 6e-18 5Z62-H nrPDB 83 2e-17 2X8A-A nrPDB 26 3.2 >6GIQ-j nrPDB Length = 83 Score = 178 bits (452), Expect = 5e-46, Method: Compositional matrix adjust. Identities = 83/83 (100%), Positives = 83/83 (100%) Query: 1 MADQENSPLHTVGFDARFPQQNQTKHCWQSYVDYHKCVNMKGEDFAPCKVFWKTYNALCP 60 MADQENSPLHTVGFDARFPQQNQTKHCWQSYVDYHKCVNMKGEDFAPCKVFWKTYNALCP Sbjct: 1 MADQENSPLHTVGFDARFPQQNQTKHCWQSYVDYHKCVNMKGEDFAPCKVFWKTYNALCP 60 Query: 61 LDWIEKWDDQREKGIFAGDINSD 83 LDWIEKWDDQREKGIFAGDINSD Sbjct: 61 LDWIEKWDDQREKGIFAGDINSD 83 >1V54-H nrPDB Length = 85 Score = 85.1 bits (209), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 34/74 (45%), Positives = 51/74 (68%), Gaps = 3/74 (4%) Query: 10 HTVGFDARFPQQNQTKHCWQSYVDYHKC---VNMKGEDFAPCKVFWKTYNALCPLDWIEK 66 T FD+RFP QNQT++CWQ+Y+D+H+C + KG D + C+ + + Y +LCP+ W+ Sbjct: 12 QTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVST 71 Query: 67 WDDQREKGIFAGDI 80 WDD+R +G F G I Sbjct: 72 WDDRRAEGTFPGKI 85 >5Z62-H nrPDB Length = 82 Score = 83.2 bits (204), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 34/73 (46%), Positives = 50/73 (68%), Gaps = 3/73 (4%) Query: 11 TVGFDARFPQQNQTKHCWQSYVDYHKC---VNMKGEDFAPCKVFWKTYNALCPLDWIEKW 67 T FD+RFP QNQT++CWQ+Y+D+H+C + KG D + C+ + + Y +LCP W+ W Sbjct: 10 TAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDW 69 Query: 68 DDQREKGIFAGDI 80 D+QR +G F G I Sbjct: 70 DEQRAEGTFPGKI 82 >2X8A-A nrPDB Length = 274 Score = 26.2 bits (56), Expect = 3.2, Method: Composition-based stats. Identities = 9/23 (39%), Positives = 15/23 (65%) Query: 38 VNMKGEDFAPCKVFWKTYNALCP 60 V + ++ APC +F+ +ALCP Sbjct: 95 VFQRAKNSAPCVIFFDEVDALCP 117 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: 6GIQ-j nrPDB 156 2e-39 1V54-H nrPDB 135 4e-33 5Z62-H nrPDB 132 5e-32 Sequences not found previously or not previously below threshold: 3G5W-A nrPDB 28 1.1 4BYF-A nrPDB 27 1.4 1D6Z-A nrPDB 26 3.8 2YEQ-A nrPDB 26 4.3 CONVERGED! >6GIQ-j nrPDB Length = 83 Score = 156 bits (394), Expect = 2e-39, Method: Composition-based stats. Identities = 83/83 (100%), Positives = 83/83 (100%) Query: 1 MADQENSPLHTVGFDARFPQQNQTKHCWQSYVDYHKCVNMKGEDFAPCKVFWKTYNALCP 60 MADQENSPLHTVGFDARFPQQNQTKHCWQSYVDYHKCVNMKGEDFAPCKVFWKTYNALCP Sbjct: 1 MADQENSPLHTVGFDARFPQQNQTKHCWQSYVDYHKCVNMKGEDFAPCKVFWKTYNALCP 60 Query: 61 LDWIEKWDDQREKGIFAGDINSD 83 LDWIEKWDDQREKGIFAGDINSD Sbjct: 61 LDWIEKWDDQREKGIFAGDINSD 83 >1V54-H nrPDB Length = 85 Score = 135 bits (340), Expect = 4e-33, Method: Composition-based stats. Identities = 34/74 (45%), Positives = 51/74 (68%), Gaps = 3/74 (4%) Query: 10 HTVGFDARFPQQNQTKHCWQSYVDYHKC---VNMKGEDFAPCKVFWKTYNALCPLDWIEK 66 T FD+RFP QNQT++CWQ+Y+D+H+C + KG D + C+ + + Y +LCP+ W+ Sbjct: 12 QTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVST 71 Query: 67 WDDQREKGIFAGDI 80 WDD+R +G F G I Sbjct: 72 WDDRRAEGTFPGKI 85 >5Z62-H nrPDB Length = 82 Score = 132 bits (331), Expect = 5e-32, Method: Composition-based stats. Identities = 34/74 (45%), Positives = 50/74 (67%), Gaps = 3/74 (4%) Query: 10 HTVGFDARFPQQNQTKHCWQSYVDYHKC---VNMKGEDFAPCKVFWKTYNALCPLDWIEK 66 T FD+RFP QNQT++CWQ+Y+D+H+C + KG D + C+ + + Y +LCP W+ Sbjct: 9 KTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTD 68 Query: 67 WDDQREKGIFAGDI 80 WD+QR +G F G I Sbjct: 69 WDEQRAEGTFPGKI 82 >3G5W-A nrPDB Length = 318 Score = 27.7 bits (60), Expect = 1.1, Method: Composition-based stats. Identities = 6/19 (31%), Positives = 11/19 (57%) Query: 62 DWIEKWDDQREKGIFAGDI 80 DW+ W ++ +G GD+ Sbjct: 145 DWVSSWANKPGEGGIPGDV 163 >4BYF-A nrPDB Length = 725 Score = 27.4 bits (59), Expect = 1.4, Method: Composition-based stats. Identities = 8/27 (29%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Query: 49 KVFWKTYNALCPLDWIEKWDDQREKGI 75 + F + Y +LCP W W + + G+ Sbjct: 634 EAFLQRYKSLCPETW-PTWAGRPQDGV 659 >1D6Z-A nrPDB Length = 727 Score = 26.2 bits (56), Expect = 3.8, Method: Composition-based stats. Identities = 8/46 (17%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Query: 40 MKGEDFAPCKVFWKTYNALCPLDWIEKWD--DQREKGIFAGDINSD 83 KG FAP + + + + W+ ++ ++ +G + D Sbjct: 616 AKGAQFAPDEWIYHRLSFMDKQLWVTRYHPGERFPEGKYPNRSTHD 661 >2YEQ-A nrPDB Length = 527 Score = 25.8 bits (55), Expect = 4.3, Method: Composition-based stats. Identities = 6/18 (33%), Positives = 9/18 (50%) Query: 63 WIEKWDDQREKGIFAGDI 80 W+ WDD + +A I Sbjct: 204 WVVTWDDHEVENNYANKI 221 Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta Posted date: Jan 3, 2023 9:05 PM Number of letters in database: 10,336,785 Number of sequences in database: 36,641 Lambda K H 0.305 0.131 0.444 Lambda K H 0.267 0.0407 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,974,873 Number of Sequences: 36641 Number of extensions: 147288 Number of successful extensions: 271 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 257 Number of HSP's gapped (non-prelim): 13 length of query: 83 length of database: 10,336,785 effective HSP length: 52 effective length of query: 31 effective length of database: 8,431,453 effective search space: 261375043 effective search space used: 261375043 T: 11 A: 40 X1: 16 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.0 bits) S2: 52 (24.7 bits)