BLASTP 2.2.23 [Feb-03-2010] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= P53833 (195 letters) Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta 36,641 sequences; 10,336,785 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value 6AGB-C nrPDB 399 e-112 3E6I-A nrPDB 32 0.16 5OQL-V nrPDB 30 0.82 3R2W-A nrPDB 28 1.8 1Q0M-A nrPDB 28 1.9 3J79-Y nrPDB 27 7.8 3JBO-AY nrPDB 27 8.1 >6AGB-C nrPDB Length = 195 Score = 399 bits (1024), Expect = e-112, Method: Compositional matrix adjust. Identities = 195/195 (100%), Positives = 195/195 (100%) Query: 1 MSGSLKSLDKKIAKRRQVYKPVLDNPFTNEAHMWPRVHDQPLIWQLLQSSIINKLIHIQS 60 MSGSLKSLDKKIAKRRQVYKPVLDNPFTNEAHMWPRVHDQPLIWQLLQSSIINKLIHIQS Sbjct: 1 MSGSLKSLDKKIAKRRQVYKPVLDNPFTNEAHMWPRVHDQPLIWQLLQSSIINKLIHIQS 60 Query: 61 KENYPWELYTDFNEIVQYLSGAHGNSDPVCLFVCNKDPDVPLVLLQQIPLLCYMAPMTVK 120 KENYPWELYTDFNEIVQYLSGAHGNSDPVCLFVCNKDPDVPLVLLQQIPLLCYMAPMTVK Sbjct: 61 KENYPWELYTDFNEIVQYLSGAHGNSDPVCLFVCNKDPDVPLVLLQQIPLLCYMAPMTVK 120 Query: 121 LVQLPKSAMDTFKSVSKYGMLLLRCDDRVDKKFVSQIQKNVDLLQFPWLNAIKYRPTSVK 180 LVQLPKSAMDTFKSVSKYGMLLLRCDDRVDKKFVSQIQKNVDLLQFPWLNAIKYRPTSVK Sbjct: 121 LVQLPKSAMDTFKSVSKYGMLLLRCDDRVDKKFVSQIQKNVDLLQFPWLNAIKYRPTSVK 180 Query: 181 LLKTTVPIVSKKRQK 195 LLKTTVPIVSKKRQK Sbjct: 181 LLKTTVPIVSKKRQK 195 >3E6I-A nrPDB Length = 476 Score = 32.0 bits (71), Expect = 0.16, Method: Compositional matrix adjust. Identities = 35/155 (22%), Positives = 67/155 (43%), Gaps = 36/155 (23%) Query: 51 IINKLIHIQSKENYPW-ELYTDFNEIVQYLSGAH----GNSDPVCLFVCNK--------D 97 + N+ H+ S PW +LY +F + YL G+H N V +V + D Sbjct: 181 LFNENFHLLST---PWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLD 237 Query: 98 PDVP-------LVLLQQ----IPLLCYMAPMTVKLVQLPKSAMDTFKSVSKYGMLLLRCD 146 P+ P LV +++ L M +TV + L + +T + +YG+L+L Sbjct: 238 PNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKY 297 Query: 147 DRVDKKFVSQIQKNV---------DLLQFPWLNAI 172 +++K +I + + D + P+++A+ Sbjct: 298 PEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAV 332 >5OQL-V nrPDB Length = 127 Score = 29.6 bits (65), Expect = 0.82, Method: Compositional matrix adjust. Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 15/84 (17%) Query: 29 NEAHMWPRVHDQPLIWQLLQSSIINKLIHIQSKENYPWELYTDFNEIVQYLSGAHGNSDP 88 NE+ WP+ D L+ +LL +Q +Y +L NE + ++ G S+ Sbjct: 4 NESAAWPKAEDPALVQELLDC--------VQQASHY-RQLKKGANETTKSVN--RGTSEL 52 Query: 89 VCLFVCNKDPDVPLVLLQQIPLLC 112 V L + PL ++ IPL+C Sbjct: 53 VILAADTQ----PLSIVLHIPLIC 72 >3R2W-A nrPDB Length = 528 Score = 28.5 bits (62), Expect = 1.8, Method: Compositional matrix adjust. Identities = 11/20 (55%), Positives = 17/20 (85%) Query: 119 VKLVQLPKSAMDTFKSVSKY 138 V++ Q+PK+ +D FKSVSK+ Sbjct: 325 VEIAQVPKAHVDEFKSVSKF 344 >1Q0M-A nrPDB Length = 117 Score = 28.5 bits (62), Expect = 1.9, Method: Compositional matrix adjust. Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Query: 62 ENYPWELYTDFNEIVQYLSGAHGNSDPV 89 E+YP EL+T NE V+ LS A ++DP Sbjct: 69 ESYP-ELHTLVNEAVKALSAAKASTDPA 95 >3J79-Y nrPDB Length = 190 Score = 26.6 bits (57), Expect = 7.8, Method: Compositional matrix adjust. Identities = 12/52 (23%), Positives = 27/52 (51%) Query: 121 LVQLPKSAMDTFKSVSKYGMLLLRCDDRVDKKFVSQIQKNVDLLQFPWLNAI 172 L++ P ++ K + + L+ CD R +KK + + KN+ ++ +N + Sbjct: 110 LIKYPLTSEKAMKKIEEINTLVFMCDKRANKKNIKKSVKNLFGIECDKVNVL 161 >3JBO-AY nrPDB Length = 101 Score = 26.6 bits (57), Expect = 8.1, Method: Compositional matrix adjust. Identities = 12/52 (23%), Positives = 27/52 (51%) Query: 121 LVQLPKSAMDTFKSVSKYGMLLLRCDDRVDKKFVSQIQKNVDLLQFPWLNAI 172 L++ P ++ K + + L+ CD R +KK + + KN+ ++ +N + Sbjct: 23 LIKYPLTSEKAMKKIEEINTLVFMCDKRANKKNIKKSVKNLFGIECDKVNVL 74 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: 6AGB-C nrPDB 397 e-111 Sequences not found previously or not previously below threshold: 3E6I-A nrPDB 32 0.22 3R2W-A nrPDB 29 1.5 5OQL-V nrPDB 28 1.7 1Q0M-A nrPDB 28 1.8 3JBO-AY nrPDB 28 2.8 3J79-Y nrPDB 28 3.0 CONVERGED! >6AGB-C nrPDB Length = 195 Score = 397 bits (1020), Expect = e-111, Method: Composition-based stats. Identities = 195/195 (100%), Positives = 195/195 (100%) Query: 1 MSGSLKSLDKKIAKRRQVYKPVLDNPFTNEAHMWPRVHDQPLIWQLLQSSIINKLIHIQS 60 MSGSLKSLDKKIAKRRQVYKPVLDNPFTNEAHMWPRVHDQPLIWQLLQSSIINKLIHIQS Sbjct: 1 MSGSLKSLDKKIAKRRQVYKPVLDNPFTNEAHMWPRVHDQPLIWQLLQSSIINKLIHIQS 60 Query: 61 KENYPWELYTDFNEIVQYLSGAHGNSDPVCLFVCNKDPDVPLVLLQQIPLLCYMAPMTVK 120 KENYPWELYTDFNEIVQYLSGAHGNSDPVCLFVCNKDPDVPLVLLQQIPLLCYMAPMTVK Sbjct: 61 KENYPWELYTDFNEIVQYLSGAHGNSDPVCLFVCNKDPDVPLVLLQQIPLLCYMAPMTVK 120 Query: 121 LVQLPKSAMDTFKSVSKYGMLLLRCDDRVDKKFVSQIQKNVDLLQFPWLNAIKYRPTSVK 180 LVQLPKSAMDTFKSVSKYGMLLLRCDDRVDKKFVSQIQKNVDLLQFPWLNAIKYRPTSVK Sbjct: 121 LVQLPKSAMDTFKSVSKYGMLLLRCDDRVDKKFVSQIQKNVDLLQFPWLNAIKYRPTSVK 180 Query: 181 LLKTTVPIVSKKRQK 195 LLKTTVPIVSKKRQK Sbjct: 181 LLKTTVPIVSKKRQK 195 >3E6I-A nrPDB Length = 476 Score = 31.5 bits (70), Expect = 0.22, Method: Composition-based stats. Identities = 38/170 (22%), Positives = 73/170 (42%), Gaps = 39/170 (22%) Query: 51 IINKLIHIQSKENYPW-ELYTDFNEIVQYLSGAH----GNSDPVCLFVCNK--------D 97 + N+ H+ S PW +LY +F + YL G+H N V +V + D Sbjct: 181 LFNENFHLLST---PWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLD 237 Query: 98 PDVP-------LVLLQQ----IPLLCYMAPMTVKLVQLPKSAMDTFKSVSKYGMLLLRCD 146 P+ P LV +++ L M +TV + L + +T + +YG+L+L Sbjct: 238 PNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKY 297 Query: 147 DRVDKKFVSQIQKNV---------DLLQFPWLNAIKYRPTSVKLLKTTVP 187 +++K +I + + D + P+++A+ + ++ T VP Sbjct: 298 PEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHE---IQRFITLVP 344 >3R2W-A nrPDB Length = 528 Score = 28.9 bits (63), Expect = 1.5, Method: Composition-based stats. Identities = 11/20 (55%), Positives = 17/20 (85%) Query: 119 VKLVQLPKSAMDTFKSVSKY 138 V++ Q+PK+ +D FKSVSK+ Sbjct: 325 VEIAQVPKAHVDEFKSVSKF 344 >5OQL-V nrPDB Length = 127 Score = 28.5 bits (62), Expect = 1.7, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 15/84 (17%) Query: 29 NEAHMWPRVHDQPLIWQLLQSSIINKLIHIQSKENYPWELYTDFNEIVQYLSGAHGNSDP 88 NE+ WP+ D L+ +LL +Q +Y +L NE + ++ G S+ Sbjct: 4 NESAAWPKAEDPALVQELLDC--------VQQASHYR-QLKKGANETTKSVN--RGTSEL 52 Query: 89 VCLFVCNKDPDVPLVLLQQIPLLC 112 V L + PL ++ IPL+C Sbjct: 53 VILAADTQ----PLSIVLHIPLIC 72 >1Q0M-A nrPDB Length = 117 Score = 28.5 bits (62), Expect = 1.8, Method: Composition-based stats. Identities = 14/27 (51%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Query: 62 ENYPWELYTDFNEIVQYLSGAHGNSDP 88 E+YP EL+T NE V+ LS A ++DP Sbjct: 69 ESYP-ELHTLVNEAVKALSAAKASTDP 94 >3JBO-AY nrPDB Length = 101 Score = 28.1 bits (61), Expect = 2.8, Method: Composition-based stats. Identities = 11/41 (26%), Positives = 22/41 (53%) Query: 121 LVQLPKSAMDTFKSVSKYGMLLLRCDDRVDKKFVSQIQKNV 161 L++ P ++ K + + L+ CD R +KK + + KN+ Sbjct: 23 LIKYPLTSEKAMKKIEEINTLVFMCDKRANKKNIKKSVKNL 63 >3J79-Y nrPDB Length = 190 Score = 27.7 bits (60), Expect = 3.0, Method: Composition-based stats. Identities = 11/41 (26%), Positives = 22/41 (53%) Query: 121 LVQLPKSAMDTFKSVSKYGMLLLRCDDRVDKKFVSQIQKNV 161 L++ P ++ K + + L+ CD R +KK + + KN+ Sbjct: 110 LIKYPLTSEKAMKKIEEINTLVFMCDKRANKKNIKKSVKNL 150 Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta Posted date: Jan 3, 2023 9:05 PM Number of letters in database: 10,336,785 Number of sequences in database: 36,641 Lambda K H 0.321 0.136 0.417 Lambda K H 0.267 0.0422 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,889,743 Number of Sequences: 36641 Number of extensions: 306933 Number of successful extensions: 655 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 647 Number of HSP's gapped (non-prelim): 14 length of query: 195 length of database: 10,336,785 effective HSP length: 92 effective length of query: 103 effective length of database: 6,965,813 effective search space: 717478739 effective search space used: 717478739 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 56 (26.1 bits)