BLASTP 2.2.23 [Feb-03-2010] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= P33308 (149 letters) Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta 36,641 sequences; 10,336,785 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value 5SVA-V nrPDB 301 6e-83 4BUB-A nrPDB 28 1.5 1WZC-A nrPDB 27 3.4 3MUN-A nrPDB 26 7.8 >5SVA-V nrPDB Length = 149 Score = 301 bits (772), Expect = 6e-83, Method: Compositional matrix adjust. Identities = 149/149 (100%), Positives = 149/149 (100%) Query: 1 MNLQNNVLNQIHQILLPTNPTLDKPNAEATKEEFSSAENRDEKDYLTNQQPKNLSTPSTS 60 MNLQNNVLNQIHQILLPTNPTLDKPNAEATKEEFSSAENRDEKDYLTNQQPKNLSTPSTS Sbjct: 1 MNLQNNVLNQIHQILLPTNPTLDKPNAEATKEEFSSAENRDEKDYLTNQQPKNLSTPSTS 60 Query: 61 SNGEFIPHIFYSLHQIRKDPNNLSNQLETLTGSIRHRLKLCKSLISENEDTKDLLSKSPS 120 SNGEFIPHIFYSLHQIRKDPNNLSNQLETLTGSIRHRLKLCKSLISENEDTKDLLSKSPS Sbjct: 61 SNGEFIPHIFYSLHQIRKDPNNLSNQLETLTGSIRHRLKLCKSLISENEDTKDLLSKSPS 120 Query: 121 EWQDIIHQREQELQIKRDVLDDLYRKLQR 149 EWQDIIHQREQELQIKRDVLDDLYRKLQR Sbjct: 121 EWQDIIHQREQELQIKRDVLDDLYRKLQR 149 >4BUB-A nrPDB Length = 498 Score = 28.1 bits (61), Expect = 1.5, Method: Composition-based stats. Identities = 11/20 (55%), Positives = 15/20 (75%) Query: 73 LHQIRKDPNNLSNQLETLTG 92 LHQ+ DP +L++ LET TG Sbjct: 304 LHQLGYDPKDLASSLETFTG 323 >1WZC-A nrPDB Length = 249 Score = 26.9 bits (58), Expect = 3.4, Method: Compositional matrix adjust. Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 5/86 (5%) Query: 17 PTNPTLDKPNAEATKEEFSSAENRDEKDYLTNQQPKNLSTPSTSSNGE--FIPHIFYSLH 74 P P +++ + F+S++ R E++Y + + TP S NG FIP ++ Sbjct: 21 PAKPIIEELKDMGFEIIFNSSKTRAEQEYYRKEL--EVETPFISENGSAIFIPKGYFPFD 78 Query: 75 QIRKDPNN-LSNQLETLTGSIRHRLK 99 K+ N + +L IR LK Sbjct: 79 VKGKEVGNYIVIELGIRVEKIREELK 104 >3MUN-A nrPDB Length = 693 Score = 25.8 bits (55), Expect = 7.8, Method: Composition-based stats. Identities = 9/25 (36%), Positives = 16/25 (64%) Query: 111 TKDLLSKSPSEWQDIIHQREQELQI 135 T D + P+ W+D+I +R+Q L + Sbjct: 309 TVDAANPGPAHWRDLIPERQQVLTV 333 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: 5SVA-V nrPDB 272 3e-74 Sequences not found previously or not previously below threshold: 4BUB-A nrPDB 30 0.40 1WZC-A nrPDB 28 1.4 4IZ5-E nrPDB 27 3.0 3MUN-A nrPDB 27 4.0 1BSF-A nrPDB 26 4.9 CONVERGED! >5SVA-V nrPDB Length = 149 Score = 272 bits (696), Expect = 3e-74, Method: Composition-based stats. Identities = 149/149 (100%), Positives = 149/149 (100%) Query: 1 MNLQNNVLNQIHQILLPTNPTLDKPNAEATKEEFSSAENRDEKDYLTNQQPKNLSTPSTS 60 MNLQNNVLNQIHQILLPTNPTLDKPNAEATKEEFSSAENRDEKDYLTNQQPKNLSTPSTS Sbjct: 1 MNLQNNVLNQIHQILLPTNPTLDKPNAEATKEEFSSAENRDEKDYLTNQQPKNLSTPSTS 60 Query: 61 SNGEFIPHIFYSLHQIRKDPNNLSNQLETLTGSIRHRLKLCKSLISENEDTKDLLSKSPS 120 SNGEFIPHIFYSLHQIRKDPNNLSNQLETLTGSIRHRLKLCKSLISENEDTKDLLSKSPS Sbjct: 61 SNGEFIPHIFYSLHQIRKDPNNLSNQLETLTGSIRHRLKLCKSLISENEDTKDLLSKSPS 120 Query: 121 EWQDIIHQREQELQIKRDVLDDLYRKLQR 149 EWQDIIHQREQELQIKRDVLDDLYRKLQR Sbjct: 121 EWQDIIHQREQELQIKRDVLDDLYRKLQR 149 >4BUB-A nrPDB Length = 498 Score = 30.1 bits (66), Expect = 0.40, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 14/84 (16%) Query: 23 DKPNAEATKEEFSSAENRD----------EKDYLTNQQPKNLSTPSTSSNGEFIPHIFYS 72 D N ++ K F +++N D E + P L T + G+F + + Sbjct: 240 DAFNRKSRKITFGTSKNADYRLGNIEVSWEGTQFVLETPDGLLKVFTRAIGDFNAYNAAA 299 Query: 73 ----LHQIRKDPNNLSNQLETLTG 92 LHQ+ DP +L++ LET TG Sbjct: 300 AIAALHQLGYDPKDLASSLETFTG 323 >1WZC-A nrPDB Length = 249 Score = 28.2 bits (61), Expect = 1.4, Method: Composition-based stats. Identities = 28/98 (28%), Positives = 44/98 (44%), Gaps = 11/98 (11%) Query: 11 IHQILLPT-NPTLDKPNAEATKEE-----FSSAENRDEKDYLTNQQPKNLSTPSTSSNGE 64 I + L+P P KP E K+ F+S++ R E++Y ++ + TP S NG Sbjct: 9 IDKTLIPGYEPDPAKPIIEELKDMGFEIIFNSSKTRAEQEYY--RKELEVETPFISENGS 66 Query: 65 --FIPHIFYSLHQIRKDPNN-LSNQLETLTGSIRHRLK 99 FIP ++ K+ N + +L IR LK Sbjct: 67 AIFIPKGYFPFDVKGKEVGNYIVIELGIRVEKIREELK 104 >4IZ5-E nrPDB Length = 133 Score = 27.0 bits (58), Expect = 3.0, Method: Composition-based stats. Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 15/77 (19%) Query: 62 NGEFIPHIFYSLHQIRKDPNNLSNQLETLTGSIRHRLKLCKSLISENEDTKDLLSKSPS- 120 N +I HIF +S + + LT + +R ++ K ISE ++ L++ PS Sbjct: 62 NLSYIEHIF-----------EISRRPDLLTMVVDYRTRVLK--ISEEDELDTKLTRIPSA 108 Query: 121 -EWQDIIHQREQELQIK 136 +++DII Q +E IK Sbjct: 109 KKYKDIIRQPSEEEIIK 125 >3MUN-A nrPDB Length = 693 Score = 26.6 bits (57), Expect = 4.0, Method: Composition-based stats. Identities = 9/25 (36%), Positives = 16/25 (64%) Query: 111 TKDLLSKSPSEWQDIIHQREQELQI 135 T D + P+ W+D+I +R+Q L + Sbjct: 309 TVDAANPGPAHWRDLIPERQQVLTV 333 >1BSF-A nrPDB Length = 278 Score = 26.2 bits (56), Expect = 4.9, Method: Composition-based stats. Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 54 LSTPSTSSNGEFIPHIFYSLHQIRKDPNN 82 L + S NGE + + Y LHQ++ +P++ Sbjct: 111 LGKKNRSLNGEKVDQVDYLLHQLKNNPSS 139 Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta Posted date: Jan 3, 2023 9:05 PM Number of letters in database: 10,336,785 Number of sequences in database: 36,641 Lambda K H 0.310 0.128 0.357 Lambda K H 0.267 0.0401 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,734,132 Number of Sequences: 36641 Number of extensions: 208184 Number of successful extensions: 585 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 572 Number of HSP's gapped (non-prelim): 19 length of query: 149 length of database: 10,336,785 effective HSP length: 88 effective length of query: 61 effective length of database: 7,112,377 effective search space: 433854997 effective search space used: 433854997 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 54 (25.4 bits)