BLASTP 2.2.23 [Feb-03-2010] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= P12273 (146 letters) Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta 36,641 sequences; 10,336,785 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value 3ES6-B nrPDB 243 2e-65 5C5C-A nrPDB 29 0.80 4S3P-A nrPDB 28 1.5 >3ES6-B nrPDB Length = 118 Score = 243 bits (620), Expect = 2e-65, Method: Compositional matrix adjust. Identities = 118/118 (100%), Positives = 118/118 (100%) Query: 29 QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTA 88 QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTA Sbjct: 1 QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTA 60 Query: 89 CLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE 146 CLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE Sbjct: 61 CLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE 118 >5C5C-A nrPDB Length = 481 Score = 28.9 bits (63), Expect = 0.80, Method: Composition-based stats. Identities = 25/94 (26%), Positives = 40/94 (42%), Gaps = 5/94 (5%) Query: 29 QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTA 88 Q +T + N + P V+P ++V V+ MV + IP +Y TA Sbjct: 96 QKDTSDVRCTNGEPPVFVKP-EKVVGVIGASGSSVSIMVANILRLFQIP---QISYASTA 151 Query: 89 C-LCDDNPKTFYWDFYTNRTVQIAAVVDVIRELG 121 L DD F+ + Q A+VD+++ LG Sbjct: 152 PELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALG 185 >4S3P-A nrPDB Length = 696 Score = 28.1 bits (61), Expect = 1.5, Method: Composition-based stats. Identities = 25/112 (22%), Positives = 53/112 (47%), Gaps = 25/112 (22%) Query: 48 PNDEVTAVLAVQTELKECMVVKTYLISSIPLQ--------GAFNYKYTACLCDDNPKTFY 99 P D++ ++LA++++ CMV+ L ++P++ G ++YK +D+ KTF Sbjct: 474 PVDDLLSILALESKRHRCMVIGEDL-GTVPVEIVGKLRSSGVYSYK-VLYFENDHEKTFR 531 Query: 100 W-DFYTNRTVQIAAVVDVI--------------RELGICPDDAAVIPIKNNR 136 Y +++ +AA D+ + LG+ PD+ + + +R Sbjct: 532 APKAYPEQSMAVAATHDLPTLRGYWECGDLTLGKTLGLYPDEVVLRGLYQDR 583 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: 3ES6-B nrPDB 242 5e-65 Sequences not found previously or not previously below threshold: 5C5C-A nrPDB 28 1.5 4S3P-A nrPDB 27 3.7 5UMD-S nrPDB 25 8.6 CONVERGED! >3ES6-B nrPDB Length = 118 Score = 242 bits (617), Expect = 5e-65, Method: Composition-based stats. Identities = 118/118 (100%), Positives = 118/118 (100%) Query: 29 QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTA 88 QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTA Sbjct: 1 QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTA 60 Query: 89 CLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE 146 CLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE Sbjct: 61 CLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE 118 >5C5C-A nrPDB Length = 481 Score = 28.1 bits (61), Expect = 1.5, Method: Composition-based stats. Identities = 25/94 (26%), Positives = 40/94 (42%), Gaps = 5/94 (5%) Query: 29 QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTA 88 Q +T + N + P V+P ++V V+ MV + IP +Y TA Sbjct: 96 QKDTSDVRCTNGEPPVFVKP-EKVVGVIGASGSSVSIMVANILRLFQIP---QISYASTA 151 Query: 89 C-LCDDNPKTFYWDFYTNRTVQIAAVVDVIRELG 121 L DD F+ + Q A+VD+++ LG Sbjct: 152 PELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALG 185 >4S3P-A nrPDB Length = 696 Score = 26.9 bits (58), Expect = 3.7, Method: Composition-based stats. Identities = 20/78 (25%), Positives = 42/78 (53%), Gaps = 11/78 (14%) Query: 48 PNDEVTAVLAVQTELKECMVVKTYLISSIPLQ--------GAFNYKYTACLCDDNPKTFY 99 P D++ ++LA++++ CMV+ L ++P++ G ++YK +D+ KTF Sbjct: 474 PVDDLLSILALESKRHRCMVIGEDL-GTVPVEIVGKLRSSGVYSYK-VLYFENDHEKTFR 531 Query: 100 W-DFYTNRTVQIAAVVDV 116 Y +++ +AA D+ Sbjct: 532 APKAYPEQSMAVAATHDL 549 >5UMD-S nrPDB Length = 187 Score = 25.4 bits (54), Expect = 8.6, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 18/42 (42%) Query: 7 LFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRP 48 L +P LLV A + N KII K +PK RP Sbjct: 19 LVSKNPYLRLLVKLYNFLARRTNANFNKIIAKRLIMPKRYRP 60 Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta Posted date: Jan 3, 2023 9:05 PM Number of letters in database: 10,336,785 Number of sequences in database: 36,641 Lambda K H 0.325 0.139 0.412 Lambda K H 0.267 0.0449 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,523,210 Number of Sequences: 36641 Number of extensions: 275707 Number of successful extensions: 660 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 656 Number of HSP's gapped (non-prelim): 10 length of query: 146 length of database: 10,336,785 effective HSP length: 88 effective length of query: 58 effective length of database: 7,112,377 effective search space: 412517866 effective search space used: 412517866 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 55 (25.7 bits)