BLASTP 2.2.23 [Feb-03-2010] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= P08525 (94 letters) Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta 36,641 sequences; 10,336,785 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value 6GIQ-H nrPDB 195 5e-51 3H1J-G nrPDB 36 0.004 1BCC-G nrPDB 32 0.067 5XTH-AA nrPDB 31 0.097 5GSL-A nrPDB 27 2.9 1OP0-A nrPDB 25 6.7 5I62-A nrPDB 25 7.3 3I9V-1 nrPDB 25 9.3 >6GIQ-H nrPDB Length = 94 Score = 195 bits (495), Expect = 5e-51, Method: Compositional matrix adjust. Identities = 94/94 (100%), Positives = 94/94 (100%) Query: 1 MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVL 60 MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVL Sbjct: 1 MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVL 60 Query: 61 IPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV 94 IPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV Sbjct: 61 IPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV 94 >3H1J-G nrPDB Length = 81 Score = 35.8 bits (81), Expect = 0.004, Method: Compositional matrix adjust. Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Query: 15 HMGG-PKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIP 62 H G + + I +Y++SP+ Q+ + IF +A+ N +RRF SQ V P Sbjct: 3 HFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPP 51 >1BCC-G nrPDB Length = 81 Score = 32.0 bits (71), Expect = 0.067, Method: Compositional matrix adjust. Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 4/71 (5%) Query: 13 WGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKN 72 +GH+ + + + +Y++SP+ Q+P F V N +RR ++ L V P ++ + Sbjct: 4 FGHLT--RVRHLITYSLSPFEQRPFPHYFSKGVPNVWRRLRACILRVAPPFLAFYLLYTW 61 Query: 73 GNEYNEFLYSK 83 G + EF SK Sbjct: 62 GTQ--EFEKSK 70 >5XTH-AA nrPDB Length = 81 Score = 31.2 bits (69), Expect = 0.097, Method: Compositional matrix adjust. Identities = 17/64 (26%), Positives = 32/64 (50%), Gaps = 2/64 (3%) Query: 20 KQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEF 79 + + + SY++SP+ Q+ +F + N RR + F V+ +++ + G E EF Sbjct: 9 RMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTE--EF 66 Query: 80 LYSK 83 SK Sbjct: 67 ERSK 70 >5GSL-A nrPDB Length = 778 Score = 26.6 bits (57), Expect = 2.9, Method: Compositional matrix adjust. Identities = 13/43 (30%), Positives = 21/43 (48%) Query: 21 QKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPA 63 + GI Y VS PL ++ N + +++ LY L+PA Sbjct: 330 KTGIYRYYVSKLKTPPLSIETQASLANVIEKDEAELLYALLPA 372 >1OP0-A nrPDB Length = 234 Score = 25.0 bits (53), Expect = 6.7, Method: Compositional matrix adjust. Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 8/47 (17%) Query: 6 GKTYMGWWGHMGGP-----KQKGITSYAVSPYAQKPLQGIFHNAVFN 47 GK G G GGP + +GI SY P Q P GI+ N VF+ Sbjct: 172 GKDTCG--GDSGGPLICNGQFQGIVSYGAHPCGQGPKPGIYTN-VFD 215 >5I62-A nrPDB Length = 534 Score = 25.0 bits (53), Expect = 7.3, Method: Compositional matrix adjust. Identities = 14/50 (28%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Query: 5 SGKTYMGWWGHMGGPKQKGITSYAV--SPYAQKPLQGIFHNAVFNSFRRF 52 SG +GW G GGPK + V P+A + + + +F+R Sbjct: 179 SGAAVLGWRGQEGGPKPTDVKQRVVWMFPFAVNIRELQVYQPLILTFQRL 228 >3I9V-1 nrPDB Length = 438 Score = 24.6 bits (52), Expect = 9.3, Method: Compositional matrix adjust. Identities = 11/41 (26%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Query: 12 WWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRF 52 W+ MG + KG+ Y +S ++P G++ + +FR Sbjct: 237 WFAQMGTEQSKGMKLYQISGPVKRP--GVYELPMGTTFREL 275 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: 6GIQ-H nrPDB 184 6e-48 Sequences not found previously or not previously below threshold: 3H1J-G nrPDB 37 0.002 5XTH-AA nrPDB 32 0.050 1BCC-G nrPDB 32 0.058 6FO0-T nrPDB 28 0.75 1QCR-G nrPDB 28 0.79 1OP0-A nrPDB 27 1.8 3I9V-1 nrPDB 27 2.5 5I62-A nrPDB 25 5.5 CONVERGED! >6GIQ-H nrPDB Length = 94 Score = 184 bits (468), Expect = 6e-48, Method: Composition-based stats. Identities = 94/94 (100%), Positives = 94/94 (100%) Query: 1 MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVL 60 MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVL Sbjct: 1 MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVL 60 Query: 61 IPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV 94 IPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV Sbjct: 61 IPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV 94 >3H1J-G nrPDB Length = 81 Score = 36.5 bits (83), Expect = 0.002, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Query: 15 HMGG-PKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIP 62 H G + + I +Y++SP+ Q+ + IF +A+ N +RRF SQ V P Sbjct: 3 HFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPP 51 >5XTH-AA nrPDB Length = 81 Score = 32.3 bits (72), Expect = 0.050, Method: Composition-based stats. Identities = 17/64 (26%), Positives = 32/64 (50%), Gaps = 2/64 (3%) Query: 20 KQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEF 79 + + + SY++SP+ Q+ +F + N RR + F V+ +++ + G E EF Sbjct: 9 RMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTE--EF 66 Query: 80 LYSK 83 SK Sbjct: 67 ERSK 70 >1BCC-G nrPDB Length = 81 Score = 31.9 bits (71), Expect = 0.058, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 4/71 (5%) Query: 13 WGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKN 72 +GH+ + + + +Y++SP+ Q+P F V N +RR ++ L V P ++ + Sbjct: 4 FGHL--TRVRHLITYSLSPFEQRPFPHYFSKGVPNVWRRLRACILRVAPPFLAFYLLYTW 61 Query: 73 GNEYNEFLYSK 83 G + EF SK Sbjct: 62 GTQ--EFEKSK 70 >6FO0-T nrPDB Length = 82 Score = 28.4 bits (62), Expect = 0.75, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 35/71 (49%), Gaps = 4/71 (5%) Query: 13 WGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKN 72 +GH+ + + + +Y++SP+ Q+ F + N RR ++ L V P ++ + Sbjct: 5 FGHL--TRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTW 62 Query: 73 GNEYNEFLYSK 83 G + EF SK Sbjct: 63 GTQ--EFEKSK 71 >1QCR-G nrPDB Length = 70 Score = 28.4 bits (62), Expect = 0.79, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 35/71 (49%), Gaps = 4/71 (5%) Query: 13 WGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKN 72 +GH+ + + + +Y++SP+ Q+ F + N RR ++ L V P ++ + Sbjct: 4 FGHL--TRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTW 61 Query: 73 GNEYNEFLYSK 83 G + EF SK Sbjct: 62 GTQ--EFEKSK 70 >1OP0-A nrPDB Length = 234 Score = 26.9 bits (58), Expect = 1.8, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 5/35 (14%) Query: 14 GHMGGP-----KQKGITSYAVSPYAQKPLQGIFHN 43 G GGP + +GI SY P Q P GI+ N Sbjct: 178 GDSGGPLICNGQFQGIVSYGAHPCGQGPKPGIYTN 212 >3I9V-1 nrPDB Length = 438 Score = 26.5 bits (57), Expect = 2.5, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 9/60 (15%) Query: 12 WWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQF-------LYVLIPAG 64 W+ MG + KG+ Y +S ++P G++ + +FR ++ + +IP G Sbjct: 237 WFAQMGTEQSKGMKLYQISGPVKRP--GVYELPMGTTFRELIYEWAGGPLEPIQAIIPGG 294 >5I62-A nrPDB Length = 534 Score = 25.4 bits (54), Expect = 5.5, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 8/63 (12%) Query: 5 SGKTYMGWWGHMGGPKQKGITSYAV--SPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIP 62 SG +GW G GGPK + V P+A + + + +F+R L+P Sbjct: 179 SGAAVLGWRGQEGGPKPTDVKQRVVWMFPFAVNIRELQVYQPLILTFQRLG------LVP 232 Query: 63 AGI 65 A + Sbjct: 233 AWV 235 Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta Posted date: Jan 3, 2023 9:05 PM Number of letters in database: 10,336,785 Number of sequences in database: 36,641 Lambda K H 0.321 0.139 0.476 Lambda K H 0.267 0.0430 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,621,966 Number of Sequences: 36641 Number of extensions: 178729 Number of successful extensions: 422 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 408 Number of HSP's gapped (non-prelim): 19 length of query: 94 length of database: 10,336,785 effective HSP length: 62 effective length of query: 32 effective length of database: 8,065,043 effective search space: 258081376 effective search space used: 258081376 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)