BLASTP 2.2.23 [Feb-03-2010] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= P01588 (193 letters) Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta 36,641 sequences; 10,336,785 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value 1CN4-C nrPDB 333 3e-92 1V7N-V nrPDB 33 0.11 2BTW-A nrPDB 32 0.13 6HEG-A nrPDB 31 0.39 3HJS-A nrPDB 30 0.91 2OME-A nrPDB 29 1.4 4AP5-A nrPDB 27 5.0 4A35-A nrPDB 27 7.4 >1CN4-C nrPDB Length = 166 Score = 333 bits (853), Expect = 3e-92, Method: Compositional matrix adjust. Identities = 163/166 (98%), Positives = 163/166 (98%) Query: 28 APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQA 87 APPRLICDSRVLERYLLEAKEAE ITTGCAEHCSLNE ITVPDTKVNFYAWKRMEVGQQA Sbjct: 1 APPRLICDSRVLERYLLEAKEAEKITTGCAEHCSLNEKITVPDTKVNFYAWKRMEVGQQA 60 Query: 88 VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS 147 VEVWQGLALLSEAVLRGQALLV SSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS Sbjct: 61 VEVWQGLALLSEAVLRGQALLVKSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS 120 Query: 148 PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR 193 PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR Sbjct: 121 PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR 166 >1V7N-V nrPDB Length = 163 Score = 32.7 bits (73), Expect = 0.11, Method: Compositional matrix adjust. Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 4/80 (5%) Query: 28 APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQA 87 APP CD RVL + L ++ + + C E L + +P + WK +A Sbjct: 3 APP--ACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKA 60 Query: 88 VEVWQGLALLSEAVL--RGQ 105 ++ + LL E V+ RGQ Sbjct: 61 QDILGAVTLLLEGVMAARGQ 80 >2BTW-A nrPDB Length = 254 Score = 32.3 bits (72), Expect = 0.13, Method: Compositional matrix adjust. Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 11/68 (16%) Query: 104 GQALLVNSS--QPWEPLQLH----VDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPL 157 G+ LL+ S + + PL + V++A G+ S+ +L +LG I+ P+ A +P Sbjct: 52 GEKLLLTSRSREDFFPLSMQFVTQVNQAYCGVASIIMVLNSLG-----INAPETAQYSPY 106 Query: 158 RTITADTF 165 R T D F Sbjct: 107 RVFTQDNF 114 >6HEG-A nrPDB Length = 809 Score = 30.8 bits (68), Expect = 0.39, Method: Compositional matrix adjust. Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 5/74 (6%) Query: 35 DSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGL 94 D+R+L L++ E + C + ++ + D + AW+R+++GQ V+V Q L Sbjct: 545 DARILLALLVDIDE---LVQRCPQLVQQSDTVEWDDAQGTLKAWRRLQIGQLTVKV-QPL 600 Query: 95 ALLSEAVLRGQALL 108 A SE L QA+L Sbjct: 601 AKPSEDELH-QAML 613 >3HJS-A nrPDB Length = 280 Score = 29.6 bits (65), Expect = 0.91, Method: Compositional matrix adjust. Identities = 13/39 (33%), Positives = 19/39 (48%) Query: 104 GQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQ 142 GQ + + PW P LH+ + G S+TT L G + Sbjct: 205 GQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGE 243 >2OME-A nrPDB Length = 336 Score = 28.9 bits (63), Expect = 1.4, Method: Compositional matrix adjust. Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 11/69 (15%) Query: 59 HCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQG--------LALLSEAVLRGQALLVN 110 HC+LNE+ +N + K+M G V +G L E +RG AL V+ Sbjct: 214 HCNLNEH---NHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVH 270 Query: 111 SSQPWEPLQ 119 S+P+ Q Sbjct: 271 ESEPFSFAQ 279 >4AP5-A nrPDB Length = 408 Score = 26.9 bits (58), Expect = 5.0, Method: Compositional matrix adjust. Identities = 16/72 (22%), Positives = 35/72 (48%), Gaps = 2/72 (2%) Query: 80 RMEVGQQAVEVWQ--GLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLR 137 R E + +E+++ G+A++ + + + +S ++H ++ + GL TT R Sbjct: 330 RFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNR 389 Query: 138 ALGAQKEAISPP 149 G Q++A P Sbjct: 390 FCGDQEKACEQP 401 >4A35-A nrPDB Length = 441 Score = 26.6 bits (57), Expect = 7.4, Method: Compositional matrix adjust. Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Query: 19 LPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITV 68 +PLG+ + C +RV+ + LL+AK + + S+NEN++V Sbjct: 296 VPLGIGIATGEQ---CHNRVIFKQLLQAKALQFLQIDSCRLGSVNENLSV 342 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: 1CN4-C nrPDB 326 3e-90 Sequences not found previously or not previously below threshold: 2BTW-A nrPDB 32 0.16 1V7N-V nrPDB 30 0.93 6HEG-A nrPDB 29 1.0 3HJS-A nrPDB 29 1.2 1IMJ-A nrPDB 27 3.9 CONVERGED! >1CN4-C nrPDB Length = 166 Score = 326 bits (837), Expect = 3e-90, Method: Composition-based stats. Identities = 163/166 (98%), Positives = 163/166 (98%) Query: 28 APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQA 87 APPRLICDSRVLERYLLEAKEAE ITTGCAEHCSLNE ITVPDTKVNFYAWKRMEVGQQA Sbjct: 1 APPRLICDSRVLERYLLEAKEAEKITTGCAEHCSLNEKITVPDTKVNFYAWKRMEVGQQA 60 Query: 88 VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS 147 VEVWQGLALLSEAVLRGQALLV SSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS Sbjct: 61 VEVWQGLALLSEAVLRGQALLVKSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS 120 Query: 148 PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR 193 PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR Sbjct: 121 PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR 166 >2BTW-A nrPDB Length = 254 Score = 32.3 bits (72), Expect = 0.16, Method: Composition-based stats. Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 11/68 (16%) Query: 104 GQALLV--NSSQPWEPLQLH----VDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPL 157 G+ LL+ S + + PL + V++A G+ S+ +L +LG I+ P+ A +P Sbjct: 52 GEKLLLTSRSREDFFPLSMQFVTQVNQAYCGVASIIMVLNSLG-----INAPETAQYSPY 106 Query: 158 RTITADTF 165 R T D F Sbjct: 107 RVFTQDNF 114 >1V7N-V nrPDB Length = 163 Score = 29.6 bits (65), Expect = 0.93, Method: Composition-based stats. Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 4/80 (5%) Query: 28 APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQA 87 APP CD RVL + L ++ + + C E L + +P + WK +A Sbjct: 3 APP--ACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKA 60 Query: 88 VEVWQGLALLSEAVL--RGQ 105 ++ + LL E V+ RGQ Sbjct: 61 QDILGAVTLLLEGVMAARGQ 80 >6HEG-A nrPDB Length = 809 Score = 29.2 bits (64), Expect = 1.0, Method: Composition-based stats. Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 5/74 (6%) Query: 35 DSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGL 94 D+R+L L++ E + C + ++ + D + AW+R+++GQ V+V Q L Sbjct: 545 DARILLALLVDIDE---LVQRCPQLVQQSDTVEWDDAQGTLKAWRRLQIGQLTVKV-QPL 600 Query: 95 ALLSEAVLRGQALL 108 A SE L QA+L Sbjct: 601 AKPSEDELH-QAML 613 >3HJS-A nrPDB Length = 280 Score = 29.2 bits (64), Expect = 1.2, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 19/39 (48%) Query: 104 GQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQ 142 GQ + + PW P LH+ + G S+TT L G + Sbjct: 205 GQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGE 243 >1IMJ-A nrPDB Length = 210 Score = 27.3 bits (59), Expect = 3.9, Method: Composition-based stats. Identities = 16/46 (34%), Positives = 22/46 (47%) Query: 111 SSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAP 156 SS+ W+ L A +G R++ L LG KEA +P AP Sbjct: 44 SSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAP 89 Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta Posted date: Jan 3, 2023 9:05 PM Number of letters in database: 10,336,785 Number of sequences in database: 36,641 Lambda K H 0.317 0.142 0.452 Lambda K H 0.267 0.0433 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,057,880 Number of Sequences: 36641 Number of extensions: 309017 Number of successful extensions: 734 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 720 Number of HSP's gapped (non-prelim): 19 length of query: 193 length of database: 10,336,785 effective HSP length: 92 effective length of query: 101 effective length of database: 6,965,813 effective search space: 703547113 effective search space used: 703547113 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 56 (26.1 bits)