BLASTP 2.2.23 [Feb-03-2010] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= B0SR19 (85 letters) Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta 36,641 sequences; 10,336,785 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value 5UHS-A nrPDB 166 2e-42 4RNG-A nrPDB 69 3e-13 4X5N-A nrPDB 62 5e-11 1X8H-A nrPDB 27 1.5 4QND-A nrPDB 25 7.0 >5UHS-A nrPDB Length = 93 Score = 166 bits (421), Expect = 2e-42, Method: Compositional matrix adjust. Identities = 84/85 (98%), Positives = 84/85 (98%) Query: 1 MENLIGYVAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRSDLPI 60 MENLIGYVAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRS LPI Sbjct: 1 MENLIGYVAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRSALPI 60 Query: 61 ILANVVTLFFVTIILYYKLTEGNQT 85 ILANVVTLFFVTIILYYKLTEGNQT Sbjct: 61 ILANVVTLFFVTIILYYKLTEGNQT 85 >4RNG-A nrPDB Length = 94 Score = 69.3 bits (168), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 29/64 (45%), Positives = 44/64 (68%) Query: 1 MENLIGYVAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRSDLPI 60 + NLIG +A +TT + +PQ L++ TK RD+S M+I +G+ LWF YG+L ++P+ Sbjct: 7 LNNLIGIIAGAITTSALIPQALKIYKTKSARDVSLAMFIFMAIGITLWFFYGVLIKEIPV 66 Query: 61 ILAN 64 ILAN Sbjct: 67 ILAN 70 >4X5N-A nrPDB Length = 100 Score = 62.0 bits (149), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 27/57 (47%), Positives = 38/57 (66%) Query: 19 PQVLRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRSDLPIILANVVTLFFVTIIL 75 PQ ++ + T+ T IS MYIMF GV+ W YGI+RSD +++AN+VTLF +L Sbjct: 21 PQSIKTIRTRNTEGISVVMYIMFLTGVISWIAYGIMRSDFAVLIANIVTLFLAAPVL 77 >1X8H-A nrPDB Length = 228 Score = 27.3 bits (59), Expect = 1.5, Method: Compositional matrix adjust. Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 5/45 (11%) Query: 23 RVVMTKQTRDISRNMYIMFFLGVVLWFVYGILR-SDLPIILANVV 66 +VV T+QTRD+ ++ + +V + G+ DLP++L NVV Sbjct: 86 KVVSTRQTRDLMKSDWAE----IVAFTRKGLPEYPDLPLVLPNVV 126 >4QND-A nrPDB Length = 101 Score = 25.0 bits (53), Expect = 7.0, Method: Compositional matrix adjust. Identities = 15/70 (21%), Positives = 36/70 (51%), Gaps = 3/70 (4%) Query: 8 VAAFLTTVSFLPQV--LRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRSDLPIILANV 65 V ++ ++ +PQ+ L V ++ +S ++++ +LW +YGI + I + N Sbjct: 21 VMGLISPLATMPQLYKLYVSHSEHALGLSLTTWLLYSFIALLWTIYGIYHKNPTIWVGNC 80 Query: 66 VT-LFFVTII 74 + L +V ++ Sbjct: 81 LGFLMYVAMV 90 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: 5UHS-A nrPDB 101 7e-23 4RNG-A nrPDB 74 1e-14 4X5N-A nrPDB 69 5e-13 Sequences not found previously or not previously below threshold: 5XPD-A nrPDB 33 0.037 3K7D-A nrPDB 30 0.35 CONVERGED! >5UHS-A nrPDB Length = 93 Score = 101 bits (252), Expect = 7e-23, Method: Composition-based stats. Identities = 84/85 (98%), Positives = 84/85 (98%) Query: 1 MENLIGYVAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRSDLPI 60 MENLIGYVAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRS LPI Sbjct: 1 MENLIGYVAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRSALPI 60 Query: 61 ILANVVTLFFVTIILYYKLTEGNQT 85 ILANVVTLFFVTIILYYKLTEGNQT Sbjct: 61 ILANVVTLFFVTIILYYKLTEGNQT 85 >4RNG-A nrPDB Length = 94 Score = 74.2 bits (181), Expect = 1e-14, Method: Composition-based stats. Identities = 33/82 (40%), Positives = 56/82 (68%) Query: 1 MENLIGYVAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRSDLPI 60 + NLIG +A +TT + +PQ L++ TK RD+S M+I +G+ LWF YG+L ++P+ Sbjct: 7 LNNLIGIIAGAITTSALIPQALKIYKTKSARDVSLAMFIFMAIGITLWFFYGVLIKEIPV 66 Query: 61 ILANVVTLFFVTIILYYKLTEG 82 ILAN+++L + +I++ K+ G Sbjct: 67 ILANLISLILIFLIIFMKIRYG 88 >4X5N-A nrPDB Length = 100 Score = 68.8 bits (167), Expect = 5e-13, Method: Composition-based stats. Identities = 36/76 (47%), Positives = 48/76 (63%) Query: 4 LIGYVAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRSDLPIILA 63 L G AAF TT +F PQ ++ + T+ T IS MYIMF GV+ W YGI+RSD +++A Sbjct: 6 LTGLFAAFFTTFAFAPQSIKTIRTRNTEGISVVMYIMFLTGVISWIAYGIMRSDFAVLIA 65 Query: 64 NVVTLFFVTIILYYKL 79 N+VTLF +L L Sbjct: 66 NIVTLFLAAPVLVITL 81 >5XPD-A nrPDB Length = 293 Score = 32.6 bits (73), Expect = 0.037, Method: Composition-based stats. Identities = 16/72 (22%), Positives = 29/72 (40%), Gaps = 2/72 (2%) Query: 4 LIGYVAAFLTTVSFLPQVLR--VVMTKQTRDISRNMYIMFFLGVVLWFVYGILRSDLPII 61 L G F ++ P + VV T+ + ++ + + V W YG+ D + Sbjct: 134 LGGICVGFSVSMFAAPLSIMRVVVRTRSVEFMPFSLSLFLTINAVTWLFYGLAIKDFYVA 193 Query: 62 LANVVTLFFVTI 73 L NV+ F + Sbjct: 194 LPNVLGAFLGAV 205 Score = 28.0 bits (61), Expect = 0.92, Method: Composition-based stats. Identities = 11/62 (17%), Positives = 27/62 (43%) Query: 4 LIGYVAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRSDLPIILA 63 ++G + +F+ ++ +P +R+ K T Y+ +LW Y + + +L Sbjct: 14 ILGNIISFVLFLAPVPTFVRICKKKSTEGFQSLPYVSALFNAMLWIYYAMQKDGTAFLLI 73 Query: 64 NV 65 + Sbjct: 74 TI 75 >3K7D-A nrPDB Length = 498 Score = 29.5 bits (65), Expect = 0.35, Method: Composition-based stats. Identities = 12/63 (19%), Positives = 30/63 (47%) Query: 17 FLPQVLRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRSDLPIILANVVTLFFVTIILY 76 +P +L V ++ ++ + +G+V Y L S+ P L ++++L + ++ Sbjct: 59 LMPHLLSDVCAREDAAVTLSRITALLVGIVTRTTYLELLSEFPAALKHLISLCAASPMIA 118 Query: 77 YKL 79 +L Sbjct: 119 SQL 121 Database: ../databases/nrPDB-GO_2019.06.18_sequences.fasta Posted date: Jan 3, 2023 9:05 PM Number of letters in database: 10,336,785 Number of sequences in database: 36,641 Lambda K H 0.329 0.146 0.417 Lambda K H 0.267 0.0448 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,243,814 Number of Sequences: 36641 Number of extensions: 108118 Number of successful extensions: 463 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 8 Number of HSP's that attempted gapping in prelim test: 444 Number of HSP's gapped (non-prelim): 26 length of query: 85 length of database: 10,336,785 effective HSP length: 54 effective length of query: 31 effective length of database: 8,358,171 effective search space: 259103301 effective search space used: 259103301 T: 11 A: 40 X1: 16 ( 7.6 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.3 bits) S2: 53 (24.9 bits)